KEGG   Pseudomonas aeruginosa M18: PAM18_3437
Entry
PAM18_3437        CDS       T01973                                 

Gene name
fabA
Definition
(GenBank) 3-hydroxydecanoyl-(acyl carrier protein) dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00061  Fatty acid biosynthesis
paf01100  Metabolic pathways
paf01212  Fatty acid metabolism
Module
paf_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAM18_3437 (fabA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paf01004]
    PAM18_3437 (fabA)
Enzymes [BR:paf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PAM18_3437 (fabA)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     PAM18_3437 (fabA)
Lipid biosynthesis proteins [BR:paf01004]
 Fatty acid synthase
  Component type
   PAM18_3437 (fabA)
SSDB
Motif
Pfam: FabA
Other DBs
NCBI-ProteinID: AEO75920
Structure
PDB: 

Position
3826459..3826974
AA seq 171 aa
MTKQHAFTREDLLRCSRGELFGPGNAQLPAPNMLMIDRIVHISDVGGKYGKGELVAELDI
NPDLWFFACHFEGDPVMPGCLGLDAMWQLVGFYLGWQGNPGRGRALGSGEVKFFGQVLPT
AKKVTYNIHIKRTINRSLVLAIADGTVSVDGREIYSAEGLRVGLFTSTDSF
NT seq 516 nt   +upstreamnt  +downstreamnt
atgaccaaacaacacgccttcacccgagaagacctgctgcgctgcagtcgcggcgagctg
ttcggcccgggtaacgcgcaacttcccgcccccaacatgctgatgatcgatcgcatcgtt
cacatcagcgatgtcggcggcaagtatggcaagggcgagctggtcgccgagctggatatc
aacccggacctgtggttcttcgcctgtcacttcgaaggcgatccggtcatgcccggttgc
ctgggcctggatgccatgtggcagctggtcggtttctacctcggctggcagggcaacccc
ggccgcggccgcgccctgggttcgggcgaagtgaagttcttcggtcaggttctgccgaca
gcgaagaaggtcacgtataacattcatatcaagcgcacgatcaatcgttcgctggtcctg
gccatcgccgacggcaccgtcagcgtcgatggccgcgaaatctacagtgccgaaggcctc
cgcgtcggcctgttcacctccactgacagcttctaa

DBGET integrated database retrieval system