KEGG   Pseudomonas aeruginosa M18: PAM18_3438
Entry
PAM18_3438        CDS       T01973                                 

Gene name
fabB
Definition
(GenBank) 3-oxoacyl-(acyl carrier protein) synthase I
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00061  Fatty acid biosynthesis
paf00780  Biotin metabolism
paf01100  Metabolic pathways
paf01212  Fatty acid metabolism
Module
paf_M00083  Fatty acid biosynthesis, elongation
paf_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PAM18_3438 (fabB)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PAM18_3438 (fabB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:paf01004]
    PAM18_3438 (fabB)
Enzymes [BR:paf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     PAM18_3438 (fabB)
Lipid biosynthesis proteins [BR:paf01004]
 Fatty acid synthase
  Component type
   PAM18_3438 (fabB)
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Other DBs
NCBI-ProteinID: AEO75921
Position
3826986..3828203
AA seq 405 aa
MRRVVITGLGIVSCLGNDKDTVSANLRAGRPGIRFNPSYAEMGLRSHVSGSVDLNLEELI
DRKVFRFMGDAAAYAYLAMEQAIKDSGLTPEQISNPRTGLIAGSGGASTLNQMEAIDTLR
EKGVKRIGPYRVTRTMGSTVSACLATPFQIKGVNYSISSACATSAHCIGQAMEQIQLGKQ
DVVFAGGGEEEHWSQSCLFDAMGALSTQYNDTPEKASRAYDAKRDGFVIAGGGGMVVVEE
LEHALKRGAKIYAEIVGYGATSDGYDMVAPSGEGAIRCMQQALATVDAPIDYLNTHGTST
PVGDVAEIRGVREVFGDKAPAISSTKSLSGHSLGAAGVHEAIYCLLMMEGGFIAGSANID
ELDPEVADLPILRETRENAKLDTVMSNSFGFGGTNATLVLKRWQG
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgcgtcgcgtcgttatcaccggtctgggcatcgtttcctgcctcggcaatgacaaagac
accgtttccgccaacctccgtgcgggtcggcccggcattcgcttcaatccgtcctacgcc
gagatgggcctgcgcagccacgtttccggttcggtcgacctgaacctcgaagagctgatc
gatcgcaaggtcttccgcttcatgggcgatgccgccgcctacgcctacctggcgatggag
caggcgatcaaggactccggcctgactccggaacagatttccaacccccgcaccggcctg
atcgccggctccggcggcgcttccaccctgaaccagatggaagccatcgacaccctgcgc
gagaaaggcgtcaagcgcatcggcccataccgcgtgacccgcaccatgggcagcaccgta
tcggcctgcctggccacaccgttccagatcaagggcgtcaactactcgatctcctccgcc
tgcgccaccagcgcgcattgcatcggccaggccatggaacagatccagttgggcaagcag
gacgtggtcttcgccggcggcggcgaagaggaacactggagccagagctgcctgttcgac
gccatgggcgccctctccacccagtacaacgacactccggaaaaggcctcccgcgcctac
gacgccaagcgtgacggcttcgtcatcgccggcggcggcggcatggtggtggtcgaggag
ctggagcatgcgctcaagcgcggcgccaagatctacgccgagatcgtcggctacggcgcc
acctccgacggctacgacatggtcgccccgagcggcgaaggcgcgatccgctgcatgcag
caggcgctggccaccgtcgacgcgccgatcgactacctgaacacccacggcacctccacc
ccggtcggcgacgtcgccgagatccgaggcgtgcgcgaagtgttcggtgacaaggcgccg
gccatcagctcgacgaagagcctgtccggccactcgctgggcgccgccggcgtgcacgag
gcgatctattgcctgctgatgatggagggcggcttcatcgccggctccgccaacatcgac
gaactcgacccggaagtggccgacctgccgattctccgcgagacccgcgagaacgccaag
ctcgataccgtcatgagcaacagcttcggcttcggcggcaccaacgccaccctggtcctc
aagcgctggcagggttga

DBGET integrated database retrieval system