KEGG   Pseudomonas aeruginosa M18: PAM18_3440
Entry
PAM18_3440        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: HxlR HTH_45 DUF5397
Other DBs
NCBI-ProteinID: AEO75923
Structure
PDB: 
2F2E

Position
3830089..3830529
AA seq 146 aa
MVKRTSHKQASCPVARPLDVIGDGWSMLIVRDAFEGLTRFGEFQKSLGLAKNILAARLRN
LVEHGVMVAVPAESGSHQEYRLTDKGRALFPLLVAIRQWGEDYFFAPDESHVRLVERDSG
QPVPRLQVRAGDGSPLAAEDTRVSRD
NT seq 441 nt   +upstreamnt  +downstreamnt
atggtcaagcgcaccagccacaagcaagccagttgtccagtcgcccgcccgctggacgtg
atcggcgacggctggtcgatgctcatcgtgcgcgatgccttcgaaggactgacgcgcttc
ggcgaattccagaagagcctcggcctggccaagaacatcctggcggcgcgcctgcgcaac
ctggtggagcacggcgtgatggtggcggtcccggccgaaagcggcagtcaccaggaatac
cgtctgactgacaagggacgcgcgctcttccccctgctggtggcgattcggcagtggggc
gaggactatttcttcgccccggacgaatcccatgtccgcctggtcgagcgcgacagcggc
cagccggtgccgcgcctgcaggtacgcgccggcgacggcagtccgctcgccgcggaagat
acccgggtcagcagggactga

DBGET integrated database retrieval system