KEGG   Pseudomonas aeruginosa M18: PAM18_3442
Entry
PAM18_3442        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: SBP_bac_3
Other DBs
NCBI-ProteinID: AEO75925
Position
3832248..3833153
AA seq 301 aa
MAFLLIGLSEHRPLPLGQGSPLRWLALLFGLLAWHAGAGERVIYPRHSEGRNPEPYVVEL
LQLALARSGGDYRLEPSAQPMPQSRAQLRLEQDDPGLQVMWAQSRDDLEETLLPIRIPIY
RGLIGWRIPLVSAANKDILASARTLDDLRRLRFGQRQDWADTPILRANGLEVKTSQNYES
LFRMLDAGRFEVFPREVVVIDGELEDASRAGLHLAIDQHVALHYPAAFYFFVSRQRPELA
EAIRQGLEKAIADGSFERLFERHFKTRLGKLALRQRRIIELKNPYLPGKTPFQREALWYR
P
NT seq 906 nt   +upstreamnt  +downstreamnt
atggcattcctcctgataggcctgagtgaacatagaccgctgccgctcggccagggttcg
ccgctccgctggctggccctgctgttcggcctgctggcctggcatgccggggctggcgaa
cgggtgatctatccgcgccattccgaagggcgcaaccccgaaccctacgtcgtcgagctg
ctgcaactggcgctggccaggagcggcggcgactaccgcctggagcccagcgcgcagccc
atgccgcagtcccgtgcgcaactgcgcctggagcaggacgatccgggcctgcaggtgatg
tgggcgcagtcccgcgacgacctggaagagaccctgctgccgatccgcattccgatctat
cgcggcctgatcggctggcgcattcccctggtcagcgccgccaacaaggatatcctggcc
tcggcgcggaccctcgacgatctccgccgcctgcgcttcggccagcgccaggactgggcc
gacacaccgatcctgcgcgccaacggcctggaggtgaagaccagccagaactacgagagc
ctgttccgcatgctcgatgccggccgcttcgaggtcttcccccgcgaggtcgtagtgatc
gacggagaactggaggacgcctcccgcgccgggctgcacctggcgatcgaccagcacgtg
gccctgcactaccccgcggccttctatttcttcgtttcgcgtcaacgcccggaactggcc
gaggccattcgccagggcctggagaaggcgattgccgacggtagcttcgaacggctgttc
gagcgacatttcaagacgcggctgggcaagcttgcccttcggcagcggagaataatcgag
ctgaaaaacccctatcttccaggaaaaactccttttcagcgcgaggcgctctggtaccgg
ccgtga

DBGET integrated database retrieval system