KEGG   Pseudomonas aeruginosa M18: PAM18_3443
Entry
PAM18_3443        CDS       T01973                                 

Definition
(GenBank) putative 5-oxo-L-prolinase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Amidohydro_2 TatD_DNase
Other DBs
NCBI-ProteinID: AEO75926
Position
complement(3831215..3832249)
AA seq 344 aa
MAGPRTRALFSTLFALSLVTSLTHARDYRYSDAHVHYVDFFQESEGMPRLLEAMDKGRVD
HVMLSGVAVAKKWHEDEPKRPRYYAGDDAGAYWYSATDVIVAAAVKSLPAEQRRRVHPFL
TGFNPTDKNADAHIRRMLELDPGLWQGIGEIFTRHDDLTALTYGDVPRANNEALARVYHL
AAEFDLPVLLHANVTSKRERNPLYLAEIEEPLRNHPHVRFIWAHAGTSMEIHRHQKKLDF
LLPTLRRLLQRYPNLYIDLSWSVLRPYLLDEQGKPDPQWLALVERFPQRFMLGSDVVGQF
DSLPELMASFDPFLDALPEQVARQVARDNFLAVLPRQPADPRGE
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggctggcccccgtacgcgtgccctgttttcgacattgttcgccctgtccctggtgaca
tccttgacccatgccagggattatcgctacagcgacgctcacgtgcactatgtggatttc
ttccaggaaagcgaaggcatgccgcggctgctggaggcgatggacaaaggccgggtcgac
catgtgatgctcagcggcgtcgcggtcgccaagaaatggcacgaggacgagccgaagcgg
ccgcgctactacgctggtgacgatgccggagcctattggtacagcgccaccgacgtgatc
gtggcggcggcggtgaaatccctgccagccgagcagcggcggcgcgtgcatccgttcctg
accggtttcaacccgaccgacaagaacgccgacgcgcacatccgtcgcatgctggagctg
gacccgggactctggcagggcatcggcgagatctttacccgtcacgacgacctcaccgcg
ctgacctacggcgacgtgccgagggccaacaacgaggcgctggcgcgggtctatcacctg
gccgccgaattcgacctgccggtgttgctgcacgccaacgtcacttccaagcgcgaacgc
aacccgctgtacctggcggaaatcgaggagcccctgcgcaatcacccgcatgtgcggttc
atctgggcccatgccgggaccagcatggagatccatcgccaccagaagaaactggacttc
ctcctgccgacccttcggcgtctgctacagcgctacccgaacctctacatcgacctgtcc
tggtcggtgttgcgcccgtacctgctggacgagcagggcaagccggatccgcagtggctg
gcactggtcgagcggtttccgcaacgcttcatgctcggttccgatgtggtcggccagttc
gacagcctgcccgagttgatggcgagcttcgatccgttcctcgacgccttgcccgagcag
gtcgctcgccaggtggcgcgggacaacttcctggcggtgctgccgcgccagcccgccgat
ccgcgaggcgaataa

DBGET integrated database retrieval system