KEGG   Pseudomonas aeruginosa M18: PAM18_3444
Entry
PAM18_3444        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
  KO
K22296  MarR family transcriptional regulator, lower aerobic nicotinate degradation pathway regulator
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:paf03000]
    PAM18_3444
Transcription factors [BR:paf03000]
 Prokaryotic type
  Helix-turn-helix
   MarR family
    PAM18_3444
SSDB
Motif
Pfam: MarR MarR_2 HTH_27 TrmB
Other DBs
NCBI-ProteinID: AEO75927
Structure
PDB: 
2NNN

Position
3833192..3833614
AA seq 140 aa
MSRNAPYRLDDQIGFILRQANQRYAALFANGIGNGLTPTQWAALVRLGETGPCPQNQLGR
LTAMDAATIKGVVERLDKRGLIQRSADPDDGRRLLVSLSPAGRAELEAGLAAAREINRQA
LAPLSPQEQETLRGLLARLT
NT seq 423 nt   +upstreamnt  +downstreamnt
atgtcccgtaacgccccgtaccgcctcgacgaccagatcggcttcatcctgcgccaagcc
aaccagcgctatgcggcgttgttcgccaatggcatcggcaacggcctgacccccacccag
tgggccgccctggtccgcctcggcgagaccggaccctgcccgcagaaccagctcggccga
ctcaccgccatggacgccgcgaccatcaagggcgtcgtcgagcgcctggacaaacgggga
ctgatccagcgcagcgccgatccggacgacggccggcgcctgctggtcagcctcagtcct
gccggacgcgccgaactcgaggccggcctggcggccgcccgcgagatcaaccggcaggcc
ttggcccccctctccccgcaagaacaggaaaccctgcgcgggttgctcgctcgcctgacc
tga

DBGET integrated database retrieval system