KEGG   Pseudomonas aeruginosa M18: PAM18_3446
Entry
PAM18_3446        CDS       T01973                                 

Definition
(GenBank) putative aldehyde dehydrogenase
  KO
K18030  nicotinate dehydrogenase subunit B [EC:1.17.2.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00760  Nicotinate and nicotinamide metabolism
paf01100  Metabolic pathways
paf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    PAM18_3446
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.2  With a cytochrome as acceptor
    1.17.2.1  nicotinate dehydrogenase (cytochrome)
     PAM18_3446
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C TAT_signal NDUF_B12
Other DBs
NCBI-ProteinID: AEO75929
Position
3834309..3836555
AA seq 748 aa
MSLANPSRRGFLKAGGLLLVTVNLPAPLLALAEQGATDLPLDQVDSFIAIAADGKVTAFC
GHVDLGTGIRTALAQIVAEELDVAFEQVEMILGDTRRTPDQGPTIASASIQVSAVPLRQA
AAEARRFLLRQAGSHFPVHPDSLRSENGQVFAAANPQRRIGYGELLRGQRFNLNIDGKAP
LKPRSEYRLVGKPVRRVDIPAKLTGQLTYVHDMRLPGMLHGRVVRPPYTGADVSAPLGSG
LLAVDESSVAGLPGLVKVVVIGDFVGVVCEREEQAIRAARQLKVRWKDWQGLPPLEPDRL
EDTLRRHPKKPRTLHGSPGLEQHLAGIARPLSATYVWPYQLHASIGPSCALAEVDAQRAR
VWSGTQNPHDLRNDLARLLQCETGDIEVIRMEAAGCYGRNGADDVSADAVLLAQAVGRPV
RVQLMREQEHGWEPKGTAQLIEVRGGLDEQGRVAAYDFATCYPSNGAPTLALLLTGRIPA
TPQVADMGDRTAIPQYRYPRMRVVANDAAPIVRASWMRGVSALPNVFAHESYVDELAHLA
GIDPIAFRRRYLDDQRALALIDALVARAGWQPRTSPNPEARRDGLLKGRGFAYARYFHSK
FPGFGAAWAAWIVDVEVNPENGAVRVAKVWVAHDCGQMVNPDGVRHQVHGNVIQSTSRVL
KEFATFDRRGVTSLEWGGYPILGFPELPEIDVLLLDRPEQPPMGAGESASVPSAAAIANA
IFDATGARLRQVPFTPERVLAALRSAQA
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgagcctggccaatccctcgcgacgcggcttcctcaaggccggcggcctgctgctggtc
accgtcaacctgcccgccccgctgctcgcccttgccgagcagggcgccaccgacctgccg
ctggaccaggtcgactcgttcatcgccattgccgcggacggcaaggtcaccgccttctgc
ggccacgtcgaccttggtaccggcatccgcacggcactggcgcagattgtcgccgaagag
ttggacgtcgcgttcgagcaggtcgagatgatcctcggcgacacccgtcgcacaccggac
caggggccgaccatcgccagcgccagcatccaggtcagcgccgtgccgctgcgccaggcc
gccgccgaagcccggcgcttcctcctgcgccaggccggaagccatttcccggtgcatccg
gacagcctgcgcagcgaaaacggccaggtcttcgccgccgccaatccgcagcgacggatc
ggctacggcgagttgctgcgaggccagcgcttcaacctgaacatcgacggcaaggcgccg
ctcaagccgcgcagcgagtaccgtctggtcggcaagccggtgcgtcgggtggacatcccg
gcgaagctgaccggtcaactgacctatgtccacgacatgcgcttgcccggcatgctgcat
ggacgagtggtacgcccgccctataccggcgcggatgtcagcgccccgctcggcagcggc
ctgctggcggtggacgaaagctcggtcgccgggctgccggggctggtcaaggtggtcgtg
atcggcgacttcgtcggcgtggtctgcgaacgcgaggagcaggcgatccgcgccgcgcgc
cagctcaaggtgcgctggaaggactggcagggcctgccgccgctggaacccgaccggctc
gaggacacgcttcgccggcatccgaagaagccacgcacgctgcacggctcacccggtctc
gagcagcacctcgcgggcatcgcccggccgctgtcggccacctatgtctggccctaccag
ttgcacgcctccatcggcccttcctgcgccctcgccgaggtcgatgcgcagcgcgctcgc
gtctggtccggcacgcagaacccgcacgacctgcgcaacgacctggccaggctgctgcag
tgcgagaccggggacatcgaggtgattcgcatggaagccgccggctgctacggacgcaac
ggcgccgacgacgtcagcgccgacgccgtgctcctggcgcaggcagtgggccggccggtg
cgggtacaactgatgcgcgaacaggaacatggctgggaaccgaaaggcaccgcgcaactg
atcgaggtccgcggcggtctcgacgagcaaggccgggtggcggcctacgacttcgccacc
tgctacccctccaacggcgcgccgaccctggccctgctcctcaccgggcggatcccggcc
accccgcaggtggccgacatgggcgaccgcaccgcgatcccgcaataccgctacccgcgg
atgcgggtggtggccaacgacgccgcccctatcgtccgcgcgtcctggatgcgcggcgtc
tcggcgctgccgaacgtgttcgcccatgagtcctacgtcgacgaactggcgcacctggcc
ggcatcgaccccatcgccttccgccgccgctacctggacgaccagcgcgccctggcgctg
atcgacgccctggtcgcccgcgccggctggcagccacgcacctcccccaacccagaggcg
cgccgggacggcttgctgaagggacgcggcttcgcctatgcgcgctacttccacagcaag
tttcccggtttcggcgccgcctgggccgcctggatcgtcgacgtcgaggtgaacccggag
aacggcgcggtgcgcgtcgccaaggtctgggtcgcccatgactgcgggcagatggtcaat
cccgatggggtcaggcaccaggtccacggcaacgtcatccagtccaccagccgggtactc
aaggagttcgccaccttcgaccgccgtggcgtcaccagcctggaatggggcggctacccg
atcctcggcttccccgaactgccggagatcgacgtactgctgctcgaccgccccgagcag
ccaccgatgggcgctggcgagtcagcctcggtgcccagcgccgcggccatcgccaatgcg
atcttcgacgctaccggggcgcgcctgcgacaggtgccgttcactccggaacgcgtactc
gcggcgctgcgcagcgcgcaggcctga

DBGET integrated database retrieval system