KEGG   Pseudomonas aeruginosa M18: PAM18_3447
Entry
PAM18_3447        CDS       T01973                                 

Definition
(GenBank) putative cytochrome c
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-ProteinID: AEO75930
Position
3836605..3837906
AA seq 433 aa
MKKATRIGLWASGSLVALAAIALGYAWQPAIGPLEGTPGPFSAEQIARGERLAALGDCAV
CHTREGGPRNAGGRALPTPFGTIYSSNLTPDRASGIGGWSYPAFERAMRHGVARDGSYLY
PAFPYTAFTRTRDEDLKALYAYLMSQPAVHSETPANQLPFPFDQRQLMAGWNLLFLEPGA
YRDEPTRNQQWNRGAYLAEGLGHCSACHSPRNALGAEKSGSAHFAGGEAEGWTAPALNAS
SPAPIAWSEEALYAYLRHGYSAYHGVASGPMAPVVGEGLAKQSDEDLRALAHYLASYAAA
PAGETDQQQAQRLDRQGYGRVQPPSGSGARLFAGACLACHHDGDGPRFFGVRPSLALNSN
VHADSPDNLLRIILDGIHSPATGDLGYMPGFRHSLDDRQVAALANYLRERFAGKPAWPDL
AAKAASLRRQAAP
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgaagaaggcaacacgcatcggcctctgggcctccggcagcctcgtcgcgctcgccgcc
atcgccctcggctacgcctggcaaccggccatcgggccactggaaggcacacccggtccc
ttcagcgccgagcagatcgcccgcggcgaacgcctcgccgccctcggcgactgcgcggtc
tgccacactcgcgaaggcggcccgcgcaacgccggcggacgggccttgccgacgccgttc
gggacgatctacagcagcaacctcacgccggatcgcgcgagcggcatcggtggctggtcc
taccccgccttcgagcgggccatgcggcatggcgtggcccgcgacggcagctacctgtat
ccggcgttcccttacaccgccttcaccaggactcgcgacgaagacctgaaggccctgtac
gcctacctgatgagccagccggcggtgcacagcgaaacgcctgccaaccagctgccgttc
cccttcgaccaacgccagctgatggccggctggaacctgctgttcctggagcccggcgcc
taccgcgacgagccgacgcgcaaccagcaatggaaccgcggcgcctatctcgccgaaggc
ctcggccattgcagcgcctgccactcgccgcgcaatgcgctcggcgcggaaaagtccggc
agcgcgcacttcgccggcggcgaggcggagggctggaccgcgccagccttgaacgccagt
tcgccggcgcccatcgcctggagcgaggaggccctctacgcctacctccgccacggctat
tcggcctaccacggggtcgccagcgggccgatggcgccagtggtcggcgaaggcctggcc
aagcagtcggacgaggacctgcgggccctggcccattaccttgcgtcctacgccgctgcc
ccggccggggaaaccgatcagcaacaggcgcaacgcctcgaccggcagggctacggccgc
gtgcaaccgcccagcggcagcggcgcgcgcctgttcgccggggcctgcctggcctgccac
catgacggcgacggaccgcgcttcttcggcgtgcgtccatccctggcgctgaacagcaat
gtgcatgcggacagcccggacaacctgctgcggatcatcctcgacggcatccacagcccg
gccaccggcgacctcggctatatgcccggcttccgccatagcctcgacgaccggcaagtc
gccgccctggccaactacctgcgcgagcgtttcgccggcaagcccgcctggccggacctc
gcggccaaggcggcaagcctgcgccgacaggcggcgccctga

DBGET integrated database retrieval system