KEGG   Pseudomonas aeruginosa M18: PAM18_3448
Entry
PAM18_3448        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: HTH_18 HTH_AraC AraC_binding Cupin_2
Other DBs
NCBI-ProteinID: AEO75931
Position
complement(3837917..3838699)
AA seq 260 aa
MPQTGQERDLPRFRSLPCAVYLRAFEMPAGHRVEMHEHPWGQLMYAASGTLRASTERHSY
LVPAQRALWIPPGVRHAAEACNPVLFRSLYLDRSLPGGCRVLEVSGLLRELLLRAAEFPR
EYPPGGEAERLMQVVADEVGRLREAPLNLPLPGDPRLRRITDALQADPADPRGISDWAGL
VGASRRTLARLFREQTQLSFREWRQRLRLLNAVAALEEGASVTRVASDLGYDSTSAFISL
FQRHFGQTPGCFARSLRLPN
NT seq 783 nt   +upstreamnt  +downstreamnt
atgccgcaaacgggacaagaacgcgacctgccgcgattccgcagcctgccctgcgcggtg
tacctgcgcgccttcgagatgcccgccgggcaccgggtggagatgcacgagcacccctgg
ggccaactgatgtacgccgccagcggcaccttgcgcgccagcaccgagcggcacagctat
ctggtgccggcgcagcgggcgctgtggattccgccgggcgtccggcacgccgcggaggct
tgcaaccctgtgctgttccgcagtctctacctggatcgttcgctgcccggcggttgccgg
gtactggaggtgtccggcctgctgcgcgaactgttgctgcgggcggcggagtttccccgt
gaatatccgccgggtggcgaggccgagcgtctcatgcaggtggtcgccgatgaggtcggg
cgccttcgcgaggcgccgctgaacctgccgttgcctggcgacccgcgcttgcgccggatc
accgacgcgctacaggcggatcccgccgatccgcgcggcatctcggattgggcgggactg
gtgggggcgtcccgacggaccctggcgcggttgttccgcgagcagacccagttgtcgttt
cgcgagtggcgccagcgcctgcgtctgctcaacgcggtcgccgcgctggaggagggcgcc
agcgtgacgcgggtggccagcgaccttggctacgactccacctcggcgttcatcagcctg
ttccagcgtcatttcggccagacccccggttgcttcgcccgctccctgcgcttgcccaac
tga

DBGET integrated database retrieval system