KEGG   Pseudomonas aeruginosa M18: PAM18_3449
Entry
PAM18_3449        CDS       T01973                                 

Gene name
panB
Definition
(GenBank) 3-methyl-2-oxobutanoate hydroxymethyltransferase
  KO
K00606  3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00770  Pantothenate and CoA biosynthesis
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
Module
paf_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PAM18_3449 (panB)
Enzymes [BR:paf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     PAM18_3449 (panB)
SSDB
Motif
Pfam: Pantoate_transf Asp_Glu_race DHDPS
Other DBs
NCBI-ProteinID: AEO75932
Position
3838780..3839601
AA seq 273 aa
MSSHRPQHRLSVPDIQRRKGAGSLVALTAYSTPMARLLDPHADLLLVGDSLGMVLYGMPS
TLGVSLEMMVAHTLAVMRGSRRACVVADLPFASYQESPRQAFRNAARLLADSGAQAVKLE
GGEEMEETVDFLVRRGIPVLAHIGLMPQQVNAMGGFKAQGRDPESAERVRRDGLAMQRGG
AFAVVIEGVGEPLARRLSEELAIPCIGIGASPACDGQVLVSEDLLGLSGEQVPRFVERYA
RLDREIDEAARRFAEDVRERRFPEARHCFAMRE
NT seq 822 nt   +upstreamnt  +downstreamnt
atgagcagtcatcgcccgcaacatcgcctgtccgttcccgatatccagcgccgcaagggt
gccggcagcctggtggcgctgaccgcctacagcacgcccatggcccgcctcctcgatccg
catgccgacctgctgctggtcggcgattcgctgggcatggtgctctatggcatgcccagc
accctgggagtgagcctggagatgatggtcgcccacaccctggcggtgatgcgcggcagt
cggcgcgcctgcgtggtggccgacttgccgttcgccagctaccaggaatcgccccgacag
gcgttccgcaacgccgcacgcctgctggccgacagcggcgcccaggcggtgaagctggaa
ggcggtgaggaaatggaagaaaccgtggacttcctggtacgccgtggcataccggtgctc
gcccatatcggcctgatgccgcagcaggtcaacgccatgggcggcttcaaggcccagggg
cgtgacccggaaagcgccgaacgggtacgccgcgacggcctcgccatgcagcgcggcggc
gccttcgcggtggtcatcgaaggcgtaggcgagccgctggcccgtcgccttagcgaagaa
ctggcgatcccctgcatcggtatcggcgcctcgccggcctgcgacggccaggtactggtc
agcgaggacctgctcgggctaagcggcgaacaggtaccgcgcttcgtcgaacgctacgcg
cgcctcgaccgggaaatcgacgaggcggcccggcgcttcgccgaggacgtgcgcgaacgg
cgcttccccgaggccaggcactgcttcgccatgcgcgagtga

DBGET integrated database retrieval system