KEGG   Pseudomonas aeruginosa M18: PAM18_3450
Entry
PAM18_3450        CDS       T01973                                 

Definition
(GenBank) putative dienelactone hydrolase family protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DLH Peptidase_S9 Glyco_transf_4 Hydrolase_4
Other DBs
NCBI-ProteinID: AEO75933
Position
complement(3839612..3840337)
AA seq 241 aa
MSEIRVEPVAYDIDGQPYEGQLVYDASHAGPRPGLLMAPNWMGVSAAALDIARQVAGRGH
VVLVADLYGRDVRPQNGDEAGAAMMPLKNDRALLRKRMQAALAALRGQALAAVDTTRQAA
FGFCFGGCCALELARDGAELKAFVSFHGTLDTPDPAHARNIKGAVLVLDGASDPLVPREQ
LPAFAREMTDAGVDWQLTSYGGAVHSFTDPNAKVPGKMHYDARTSRRAFQAMDDLLAEVF
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgagtgagattcgtgtagagccggtcgcctacgacatcgatgggcagccgtacgaaggt
caactggtgtacgacgccagccacgcggggccgcgcccgggcctgctgatggcgccgaac
tggatgggcgtgagcgccgccgcgctggacatcgcccggcaggtcgccggccgtgggcac
gtggtgctggtggcggacctctacggcagggacgtgcgtccgcagaacggcgacgaggcg
ggcgcggcgatgatgccgctgaagaacgaccgggccctgctgcgcaagcgcatgcaggca
gcgctggcggccttgcgcggacaggcgctcgcggctgtcgatacgacccgccaggccgcc
ttcggtttctgcttcggcggttgctgcgcgctggagctggctcgcgacggcgccgagctg
aaggccttcgtgtccttccatggcaccctggatacgccggacccggcgcatgccaggaat
atcaagggcgcggtactggtcctcgacggcgcctccgatccgctggtgccgcgcgagcag
ttgccggccttcgccagggagatgaccgatgccggcgtcgactggcagctcaccagctac
ggcggcgcggtgcattccttcaccgatccgaacgccaaggtgccgggcaagatgcactat
gacgccaggacctcccggcgtgccttccaggcgatggacgacctgctggcggaagtcttc
gcctga

DBGET integrated database retrieval system