KEGG   Pseudomonas aeruginosa M18: PAM18_3451
Entry
PAM18_3451        CDS       T01973                                 

Gene name
htpG
Definition
(GenBank) heat shock protein 90
  KO
K04079  molecular chaperone HtpG
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:paf01009]
    PAM18_3451 (htpG)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:paf03110]
    PAM18_3451 (htpG)
   04131 Membrane trafficking [BR:paf04131]
    PAM18_3451 (htpG)
   03051 Proteasome [BR:paf03051]
    PAM18_3451 (htpG)
   03029 Mitochondrial biogenesis [BR:paf03029]
    PAM18_3451 (htpG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paf04147]
    PAM18_3451 (htpG)
Protein phosphatases and associated proteins [BR:paf01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     PAM18_3451 (htpG)
Chaperones and folding catalysts [BR:paf03110]
 Heat shock proteins
  HSP90
   PAM18_3451 (htpG)
Membrane trafficking [BR:paf04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    PAM18_3451 (htpG)
Proteasome [BR:paf03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    PAM18_3451 (htpG)
Mitochondrial biogenesis [BR:paf03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    PAM18_3451 (htpG)
Exosome [BR:paf04147]
 Exosomal proteins
  Proteins found in most exosomes
   PAM18_3451 (htpG)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4795
Other DBs
NCBI-ProteinID: AEO75934
Position
complement(3840405..3842309)
AA seq 634 aa
MSVETQKETLGFQTEVKQLLHLMIHSLYSNKEIFLRELISNASDAADKLRFEALANPELL
EGGAELKIRVSFDKEANTVTLEDNGIGMSREDVVTHLGTIAKSGTADFLKNLSGDQKKDS
HLIGQFGVGFYSAFIVADKVDVYSRRAGQPASEGVHWSSKGEGEFDVATIDKPERGTRIV
LHLKKGEEEFADGWRLRNVIKKYSDHIALPIELPKEFHGEEADKPAEPEWETVNRASALW
TRPRAEVKDEEYQEFYKHVAHDFENPLSWSHNKVEGKLEYTSLLYVPGRAPFDLYHREAP
RGLKLYVQRVFIMDQADEFLPLYLRFIKGVVDSNDLSLNVSREILQKDPVIDSMKSALTK
RVLDMLEKLAKNEPEQYKTFWKNFGQVLKEGPAEDFGNKEKIAGLLRFASTGDDSGEQSV
ALADYIGRMKEGQDKIYYLTGESYSQVKNSPHLEVFRKKGIEVLLLTDRIDEWLMSYLPE
FDGKQFVDVARGDLDLGSLDSEEDKKAQEEVAKSKEGLIERLKKVLDEQVSEVRVSHRLT
DSPAILAIGEQDLGLQMRQILEASGQKVPDSKPIFEINPQHPLIEKLDAEPDEDRFGELS
HILFDQAALAAGDSLKDPGAYVRRLNKLLVELSA
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgagcgtggaaacccaaaaagagacactgggctttcagactgaagtgaagcaactgctt
cacctgatgattcattctctctattcgaacaaggaaatcttcctccgcgaactgatttcc
aacgcctcggacgccgccgacaagctgcgtttcgaagccctggccaatcccgagctgctc
gagggcggcgccgagttgaagatccgcgtcagcttcgacaaggaagccaacaccgtcacc
ctggaagacaacggcatcggcatgagccgcgaggatgtggtgactcacctgggcaccatc
gccaagtccgggaccgccgacttcctgaagaacttgtctggcgaccagaagaaggattcg
cacctgatcggccagttcggcgtcggtttctacagcgccttcatcgtcgccgacaaggtc
gatgtctactcccgtcgcgccggccagccggccagcgaaggggtgcactggtcgtcgaag
ggcgagggcgagttcgacgtcgctaccatcgacaagcccgagcgcggtacccgcatcgtc
ctccacctgaaaaagggcgaggaggagttcgccgatggctggcgcctgcgcaacgtgatc
aagaaatactccgatcacatcgctttgccgatcgagctgcccaaggaattccacggcgaa
gaggccgacaagccggccgagccggaatgggaaacggtcaaccgcgccagcgcgctgtgg
acccgtccgcgcgccgaggtgaaggacgaggaataccaggagttctacaagcacgtcgcc
catgacttcgagaacccgctgagctggagccacaacaaggtcgaaggcaagctggaatac
acctcgctgctctacgtgccgggccgcgcgccgttcgacctgtaccatcgcgaagcgccg
cggggcctgaagctgtacgtacagcgcgtgttcatcatggaccaggccgacgagttcctg
ccgctgtacctgcgcttcatcaagggtgtggtcgactccaacgacctgtcgctgaacgtc
tcccgggaaatcctgcagaaggatccggtgatcgactcgatgaagtcggcgttgaccaag
cgcgtgctggacatgctggagaagctggcgaagaacgagccggagcagtacaagaccttc
tggaagaacttcggccaggtcctcaaggaaggcccggcggaagacttcggcaacaaggag
aagatcgccggcctgctgcgcttcgcctccaccggcgacgattcgggcgagcagagcgta
gcgctggccgactacatcggtcggatgaaggaaggccaggacaagatctactacctcacc
ggcgagagctactcgcaggtgaagaacagcccgcacctggaagtcttccgcaagaagggc
atcgaggtgctgctgctcaccgatcgcatcgacgagtggctgatgagctacctgccggag
ttcgacggcaagcagttcgtcgatgtcgcccgcggcgacctggacctgggcagcctagac
tcggaagaggacaagaaggcccaggaagaagtcgccaagagcaaggaaggcctgatcgag
cgcctgaagaaggtgctcgacgagcaggtcagcgaagtccgcgtttcccaccgcctgacc
gattcgccggcgatcctcgccatcggcgaacaggaccttggcctgcagatgcgccagatc
ctcgaggccagcgggcagaaagtgccggactcgaagccgatcttcgagatcaacccgcag
catccgctgatcgagaagctggatgcggagccggacgaggaccgcttcggcgagctgtcg
catattctcttcgaccaggccgccctggccgcgggggacagcctcaaggatccgggcgcc
tacgtacgccgactgaacaagctgctggtggagctgtccgcttaa

DBGET integrated database retrieval system