KEGG   Pseudomonas aeruginosa M18: PAM18_3453
Entry
PAM18_3453        CDS       T01973                                 

Definition
(GenBank) putative thioesterase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: 4HBT 4HBT_3
Other DBs
NCBI-ProteinID: AEO75936
Position
complement(3843696..3844142)
AA seq 148 aa
MSPTSLEQLVRDARRNNDYSPLVELIPYAKLLGIECLRLGDDMVFRLPANKDNIGNPTLP
AIHGGVIAGFMEHAAMLHLLTFMSIPHLPKIIDFSIDYLRAGHFRDTYAQCQVWRQGRRV
ANVAINAWQTTQGEPIATARAHFKVDEP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgagcccgaccagcctcgagcaactggtccgcgacgcgcgtcggaacaacgactacagc
ccgctggtggagctgatcccgtacgccaagctgctcggcatcgaatgcctgcgcctgggc
gacgacatggtcttccgcctgccggcgaacaaggacaacatcggcaacccgaccctgccg
gccatccatggcggcgtgatcgccggcttcatggagcatgcggcgatgttgcacctgctg
accttcatgagcattccgcacctgccgaagatcatcgatttctccatcgattacctgcgt
gccgggcacttccgcgatacctacgcgcaatgccaggtctggcgccaggggcgacgggtg
gcgaacgtcgcgatcaacgcctggcagaccacccagggcgagcccatcgccaccgcgcgg
gcgcatttcaaggtggacgagccgtga

DBGET integrated database retrieval system