KEGG   Pseudomonas aeruginosa M18: PAM18_3454
Entry
PAM18_3454        CDS       T01973                                 

Definition
(GenBank) putative thioesterase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: 4HBT
Other DBs
NCBI-ProteinID: AEO75937
Structure
PDB: 
3F1T

Position
complement(3844139..3844612)
AA seq 157 aa
MSENPLLERARRFLSALRHCQVLGLTVEAADEKGLTLRLPYSQAIIGNPESGVVHGGAIT
TLMDTTCGISTVCVLPDFEICPTLDLRIDYMHPAEPHKDVYGFAECYRVTPNVIFTRGFA
YQDDPGQPIAHVVGAFMRMGGSARAGAARPAAQGGAA
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtcggaaaatcctctcctcgagcgcgcccggcgctttctctcggccttgcgtcattgc
caggtgctggggttgacggtcgaggccgccgacgagaaaggactgaccctgcgcctgccc
tacagccaggcgatcatcggcaacccggaaagcggggtcgtccacggcggcgcgatcacc
accctgatggacaccacctgtggtatttccacggtctgcgtgctgccggacttcgagatc
tgcccgacgctcgacctgcgcatcgactacatgcatcccgccgaaccgcacaaggatgtc
tatggcttcgccgagtgctaccgggtcacgccgaacgtgatcttcacccgcggcttcgcc
taccaggacgatccaggccagcccatcgcccatgtcgtcggcgctttcatgcgcatgggc
ggttcggcccgcgccggggcggccaggccggccgcgcagggaggtgcggcatga

DBGET integrated database retrieval system