KEGG   Pseudomonas aeruginosa M18: PAM18_3455
Entry
PAM18_3455        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: FAP CCDC53
Other DBs
NCBI-ProteinID: AEO75938
Position
3844785..3845021
AA seq 78 aa
MKKTVTLALLLAASLGLAACDKKEEDKAAAPAAPATETQPSAPATPPAEPSAPAPSSDTP
ATPQTPAPTPEQPQQNQQ
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaaaaagaccgtaactcttgccctgctgctcgctgccagccttggcctggccgcttgc
gacaagaaagaggaagacaaggcagcggccccggcagctccggctaccgagacccagccg
agcgctccggctactccccctgccgagcccagcgccccggcgccgtcgagcgacactccg
gcaaccccgcagactccggcaccgactccggagcaaccgcaacagaaccagcaataa

DBGET integrated database retrieval system