KEGG   Pseudomonas aeruginosa M18: PAM18_3456
Entry
PAM18_3456        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DUF599
Other DBs
NCBI-ProteinID: AEO75939
Position
complement(3845080..3845844)
AA seq 254 aa
MTAELGIFNGHLLQHLLAALWFLFCWVGYTRYATWKGRDTACLASVLHLYREDWMRRLLL
RDNRIADASVIGNLERNASFFASSTLIILAGILTLLGSTDRAVSVLADLPFVEEASRGLS
ELKLLCLAVVFVYAFFTFSWCMRQYNFAAILVGSAPMIGERNVGELERKSFAERAARVIS
LAANQFNFGLRSYYFGLAMLAWFINSWFFMLVTAGVVLVLYRREFHSDVLEVMVYTETAI
AESPREGEGEVPRG
NT seq 765 nt   +upstreamnt  +downstreamnt
atgaccgccgaactcggcattttcaacgggcacctgctgcaacacctgctggcggcgctc
tggttcctgttctgctgggtgggctacacccgctacgccacctggaagggtcgcgacacc
gcctgcctggccagcgtcctgcacctctaccgggaggactggatgcgccggttgctgctg
cgcgacaaccgtatcgccgacgccagcgtgatcggtaacctggagcgtaacgcgtcgttc
ttcgcctccagcacgctgatcatcctcgccggcatcctcaccctgctgggctccaccgat
cgcgccgtctcggtactggccgacctgccgttcgtggaggaggccagccggggactatcg
gaactgaagctgctgtgcctggcagtggtcttcgtctatgccttcttcaccttcagctgg
tgcatgcgccaatacaacttcgcggcgatcctggtcggctcggcaccgatgatcggcgag
cgcaacgtcggcgagctggagcgcaaatcctttgccgagcgtgccgcccgggtcatctcg
ctggcggccaaccagttcaacttcggcttgcgctcgtactatttcggcctggccatgctc
gcctggttcatcaattcctggttcttcatgctggtgacggccggcgtggtgctggtcctg
tatcgccgcgaattccattcggacgtgctggaggtgatggtctacaccgagaccgcaatc
gccgaaagcccgcgggaaggcgagggcgaggtgcccaggggctga

DBGET integrated database retrieval system