KEGG   Pseudomonas aeruginosa M18: PAM18_3457
Entry
PAM18_3457        CDS       T01973                                 

Gene name
braB
Definition
(GenBank) branched chain amino acid transporter
  KO
K03311  branched-chain amino acid:cation transporter, LIVCS family
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PAM18_3457 (braB)
SSDB
Motif
Pfam: Branch_AA_trans
Other DBs
NCBI-ProteinID: AEO75940
Position
complement(3845990..3847303)
AA seq 437 aa
MTHLKGFDLLALGFMTFALFLGAGNIIFPPSAGMAAGEHVWSAAFGFLLTGVGLPLLTVV
ALARVGGGIGRLTQPIGRRAGVAFAIAVYLAIGPLFATPRTAVVSFEMGVAPFTGDGGVP
LLIYTVAYFSVVLFLVLNPGRLVDRVGKVITPVLLSALLVLGGAAIFAPAGEIGSSSGEY
QSAPLVQGFLQGYLTMDTLGALVFGIVIATAIRDRGISDSRLVTRYSMIAGVIAATGLSL
VYLALFYLGATSQGIAGDAQNGVQILTAYVQQTFGVSGSLLLAVVITLACLTTAVGLITA
CGEFFSDLLPVSYKTVVIVFSLFSLLVANQGLTQLISLSVPVLVGLYPLAIVLIALSLFD
RLWVSAPRVFVPVMIVALLFGIVDGLGAAKLNGWVPDVFAKLPLADQSLGWLLPVSIALV
LAVVCDRLLGKPREAVA
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgactcatttgaaagggttcgacctgctcgcccttggcttcatgacgttcgcgcttttt
ctcggcgcgggtaacatcatctttcctcccagtgccggcatggcggcgggcgaacacgta
tggagcgcggctttcggcttcctccttaccggtgtcggcctgccgttgctgacggtggtc
gccctggcccgggtcggaggcggtattggccgcctgacccagccgatcgggcggcgcgcg
ggagtggcgttcgccatcgccgtctatcttgccatcggcccgctgttcgccaccccgcgt
acagccgtggtgtccttcgagatgggcgtcgcgcccttcaccggggacggcggcgtgccg
ttgctcatctataccgtcgcttacttctccgtggttctgttcctggtgctgaacccgggt
cgccttgtcgaccgggtcggaaaggtcatcacgccggtgctgctgtcggccctgctggtc
cttggcggcgcggcgatcttcgcgccggcgggagagatcggcagcagttccggcgagtac
cagagcgcgcccctggtgcagggcttcctgcagggctacctgaccatggataccctcggt
gcgctggtcttcggtatcgtcatcgccaccgccattcgcgaccgcggcatcagcgacagc
cggctggtcacgcgctattccatgatcgccggggtcatcgccgccaccggcctgtccctg
gtctacctggcgctgttctatcttggcgccaccagccagggcatcgccggcgacgcccag
aatggcgtacagatcctcaccgcctatgtgcagcagacctttggcgtttccggcagcctg
ttgctggcggtggtcatcaccctggcctgcctgaccacggcggtagggctgatcacggcg
tgcggcgagttcttcagcgacctgctgccggtttcgtacaagacggtggtgatcgtgttc
tcgctgttcagcctgctggtcgccaaccagggactgacccagttgatcagcctttcggta
ccggttctggtgggactctatccgctcgccatcgtgctgatcgccctgagcctgttcgac
cggctctgggtgtcggccccgcgggtgttcgtgccggtgatgatcgtcgcgctgctcttc
ggcatcgtcgacgggctgggggcggccaagctgaacgggtgggtgccggacgtcttcgcc
aagcttccgctcgccgatcagagccttggctggctgctgccggtatccattgcgctggtc
ctggcagtcgtttgcgatcggctgctgggcaagccgcgcgaagcggtcgcctga

DBGET integrated database retrieval system