KEGG   Pseudomonas aeruginosa M18: PAM18_3458
Entry
PAM18_3458        CDS       T01973                                 

Gene name
sucD
Definition
(GenBank) succinyl-CoA synthetase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00640  Propanoate metabolism
paf00660  C5-Branched dibasic acid metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3458 (sucD)
   00640 Propanoate metabolism
    PAM18_3458 (sucD)
   00660 C5-Branched dibasic acid metabolism
    PAM18_3458 (sucD)
Enzymes [BR:paf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PAM18_3458 (sucD)
SSDB
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Other DBs
NCBI-ProteinID: AEO75941
Position
complement(3847614..3848501)
AA seq 295 aa
MSVLINKDTKVICQGFTGSQGTFHSEQAIAYGTKMVGGVTPGKGGTTHLGLPVFNTVKEA
VEATGAEASVIYVPAPFCKDSILEAAFGGIKLIVCITEGIPTLDMLDAKVKCDELGVRLI
GPNCPGVITPGECKIGIMPGHIHLPGKVGIVSRSGTLTYEAVKQTTDAGFGQSTCVGIGG
DPIPGSNFIDILKLFQEDPQTEAIVMIGEIGGSAEEEAAAFIKANVTKPVVSYIAGVTAP
PGKRMGHAGAIISGGKGTADEKFAALQDAGVKTVRSLADIGKALAELTGWEVKKA
NT seq 888 nt   +upstreamnt  +downstreamnt
atgagcgtcctgatcaacaaagacaccaaagtcatctgccaaggcttcaccggtagccag
ggcaccttccactccgaacaggccatcgcctatggcaccaagatggtcggcggcgtgacc
cccggcaagggcggcaccacccacctcggcctgccggtgttcaacaccgtcaaggaagcc
gtggaagccaccggcgccgaagcctcggtcatctacgttccggctccgttctgcaaggac
tcgatcctggaagcggcattcggcggcatcaagctgatcgtctgcatcaccgaaggcatc
ccgaccctcgacatgctggacgccaaggtcaagtgcgacgagctgggcgtacgcctgatc
ggcccgaactgcccgggcgtgatcactcccggcgagtgcaagatcggcatcatgccgggt
cacatccacctgccgggcaaggtaggcatcgtgtcgcgttccggcaccctgacctacgaa
gccgtgaagcagaccaccgacgccggcttcggccagtccacctgcgtgggcatcggcggc
gacccgatcccgggctccaacttcatcgacatcctgaagctgttccaggaagatccgcag
accgaagccatcgtcatgatcggcgagatcggcggttccgccgaagaagaagccgcggcc
ttcatcaaggccaacgtgaccaagccggtggtgtcctacatcgctggtgtgactgcccct
ccgggcaagcgcatgggccacgccggcgccatcatctccggcggcaagggcaccgcggac
gagaagttcgccgccctgcaggacgccggtgtgaagaccgtgcgttccctggccgacatc
ggcaaggccctggccgagctgaccggttgggaagtgaagaaggcctga

DBGET integrated database retrieval system