KEGG   Pseudomonas aeruginosa M18: PAM18_3460
Entry
PAM18_3460        CDS       T01973                                 

Gene name
lpdG
Definition
(GenBank) dihydrolipoamide dehydrogenase
  KO
K00382  dihydrolipoamide dehydrogenase [EC:1.8.1.4]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00010  Glycolysis / Gluconeogenesis
paf00020  Citrate cycle (TCA cycle)
paf00260  Glycine, serine and threonine metabolism
paf00280  Valine, leucine and isoleucine degradation
paf00310  Lysine degradation
paf00380  Tryptophan metabolism
paf00620  Pyruvate metabolism
paf00630  Glyoxylate and dicarboxylate metabolism
paf00640  Propanoate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paf_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
paf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAM18_3460 (lpdG)
   00020 Citrate cycle (TCA cycle)
    PAM18_3460 (lpdG)
   00620 Pyruvate metabolism
    PAM18_3460 (lpdG)
   00630 Glyoxylate and dicarboxylate metabolism
    PAM18_3460 (lpdG)
   00640 Propanoate metabolism
    PAM18_3460 (lpdG)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PAM18_3460 (lpdG)
   00280 Valine, leucine and isoleucine degradation
    PAM18_3460 (lpdG)
   00310 Lysine degradation
    PAM18_3460 (lpdG)
   00380 Tryptophan metabolism
    PAM18_3460 (lpdG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paf04147]
    PAM18_3460 (lpdG)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.4  dihydrolipoyl dehydrogenase
     PAM18_3460 (lpdG)
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   PAM18_3460 (lpdG)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox Pyr_redox_3 GIDA FAD_binding_2 FAD_oxidored FAD_binding_3 HI0933_like Thi4 3HCDH_N NAD_binding_8 DAO AlaDh_PNT_C K_oxygenase 2-Hacid_dh_C Lycopene_cycl UDPG_MGDP_dh_N Amino_oxidase
Other DBs
NCBI-ProteinID: AEO75943
Structure
PDB: 
5U8U 5U8V 5U8W

Position
complement(3849996..3851432)
AA seq 478 aa
MSQKFDVVVIGAGPGGYVAAIRAAQLGLKTACIEKYIGKEGKVALGGTCLNVGCIPSKAL
LDSSYKYHEAKEAFKVHGIEAKGVTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEG
HGKLLANKQVEVTGLDGKTQVLEAENVIIASGSRPVEIPPAPLTDDIIVDSTGALEFQAV
PKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPAADEQIAKEALKVLTKQGLNIR
LGARVTASEVKKKQVTVTFTDANGEQKETFDKLIVAVGRRPVTTDLLAADSGVTLDERGF
IYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEGVMVAERIAGHKAQMNYDLIPSVIYTH
PEIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVI
GPSAAELVQQGAIGMEFGTSAEDLGMMVFSHPTLSEALHEAALAVNGHAIHIANRKKR
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgagccagaaattcgacgtggtagtgattggtgccggccccggcggttacgttgccgcc
atccgcgctgcccagctgggcctgaagaccgcctgcatcgagaagtacatcggcaaggaa
ggcaaggtggcgctcggcggtacctgcctgaacgttggctgcatcccgtccaaggcgctg
ctggacagctcctacaagtaccatgaggccaaagaggccttcaaagtccatggtatcgaa
gccaagggcgtcaccatcgacgttccggcgatggttgcgcgcaaggccaacatcgtcaag
aacctgaccggcggcatcgctaccctgttcaaggccaacggcgtgacctccttcgaaggc
cacggcaagctgctggccaacaagcaggtggaagtgaccggtctggacggcaagacccag
gtcctggaagccgagaacgtgatcatcgcttccggctcccgcccggtggagatcccgccg
gccccgctgaccgacgacatcatcgtcgactccaccggcgccctggaattccaggccgta
ccgaagaagctgggtgtgatcggcgccggcgtcatcggcctggagctgggttcggtatgg
gcccgcctgggtgccgaggtgaccgtgctggaagccctggacaagttcctcccggctgcc
gacgagcagattgccaaggaagccctgaaggtcctgaccaagcaaggcctgaacattcgc
ctgggtgcccgcgtgaccgcttcggaagtgaagaagaagcaggtcaccgtgaccttcacc
gacgccaacggcgagcagaaggaaaccttcgacaagctgatcgtcgcggtcggccgtcgc
ccggtgaccaccgacctgctggccgccgacagcggcgtgaccctggacgagcgtggcttc
atctacgtcgacgaccactgcaagaccagcgttccgggcgtcttcgccatcggtgacgtg
gttcgcggcgcgatgctcgcgcacaaagcctcggaagagggcgtgatggtcgccgagcgc
atcgccggccacaaggcgcagatgaactacgacctgattccgtcggtcatctacacccac
ccggaaatcgcctgggtcggcaagaccgagcagaccctcaaggccgagggcgtcgaagtc
aacgtcggcaccttcccgttcgccgccagcggtcgcgcgatggctgccaacgacaccacc
ggcctggtcaaggtcatcgccgatgcgaagaccgaccgcgtcctgggcgtccacgtgatc
ggcccgagcgccgccgagctggtacagcaaggcgcgatcggcatggaattcggcaccagc
gccgaagacctgggcatgatggtcttctctcacccgacgctgtccgaagccctgcacgaa
gctgccctggcagtgaatggccatgccatccacatcgccaaccgcaagaagcgctga

DBGET integrated database retrieval system