KEGG   Pseudomonas aeruginosa M18: PAM18_3462
Entry
PAM18_3462        CDS       T01973                                 

Gene name
sucA
Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3462 (sucA)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     PAM18_3462 (sucA)
SSDB
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N PFOR_II
Other DBs
NCBI-ProteinID: AEO75945
Position
complement(3852773..3855589)
AA seq 938 aa
MQRMWNSAHLSGGNAAYVEELYELYLHDPNAVPEEWRTYFQKLPADGNPAPDVSHSTVRD
HFVLLAKNQRRAQPVSAGSVSSEHEKKQVEVLRLIHAYRLRGHQASTLDPLGLWQRPAPA
DLSIDHYGLTGADLDTTFRTGELYIGKEEATLREIVDSLKSTYCGTFGAEFMHIVDSEQR
KWFLQRLESVRGRPGFSAEARAHLLERLTAAEGLEKYLGTKYPGTKRFGLEGGESLIPMV
DEIIQRCGSYGAKEIVIGMAHRGRLNVLVNTLGKNPRDLFDEFEGKKIVELGSGDVKYHQ
GFSSNVMTSGGEVHLALAFNPSHLEIVSPVVEGSVRARQDRRKDSSGDKVVPISIHGDAA
FAGQGVVMETFQMSQTRAYKTGGTIHLVINNQVGFTTSRQDDARSTEYATDVAKMIQAPI
FHVNGDDPEAVLFVTQLAVDYRMQFKRDVVIDLVCYRRRGHNEADEPSGTQPLMYQQIAK
QRTTRELYADALVNAGVLSAEQVQSKIDDYRDALDNGLHVVKSLVKEPNKELFVDWRPYL
GHAWTARHDTRFDLKTLQELSSKMLEVPEGFVVQRQVSKIYEDRQKMAAGGLPINWGFAE
TLAYATLLFEGHPVRMTGQDVGRGTFSHRHAVLHNQKDDSVYVPLANLFDGQPRLDIYDS
FLSEEAVLAFEYGFATTTPNSLVIWEAQFGDFANGAQVVIDQFITSGESKWGRLCGLTML
LPHGYEGQGPEHSSARLERYLQLCAEQNIQVCVPTTPAQVYHMLRRQVIRPLRKPLVVMT
PKSLLRHKLAISTLEDLANGSFQTVIPEIDSLDPKKVDRVVLCSGKVYYDLLEKRRAEGR
EDTAIVRIEQLYPFPEDDLAEVLAPYKNLKHIVWCQEEPMNQGAWFCSQHHMRRVIAAHK
KGLNLEYAGREGSAAPACGYASMHAEQQEKLLQDAFTV
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgcagcggatgtggaacagtgcccatctatccggtggtaacgctgcctacgtcgaagag
ctctacgagctctacctgcacgaccctaacgctgtgccagaagagtggcgcacgtatttc
cagaagcttcccgccgatggcaatcccgcccccgacgtctcgcactccacagtgcgcgat
catttcgtcctgctggccaagaaccagcgccgtgcccagccggtttccgccggtagcgtg
agcagcgagcacgagaagaagcaggtcgaagtccttcgtctcattcacgcttaccgtctc
cgcggccaccaggcttccaccctcgacccgctcggcctgtggcagcgtcccgcgcctgcc
gacctgtcgatcgaccactacggtctgacgggtgccgacctggacaccactttccgcacc
ggtgagctttacatcggcaaggaagaggcgaccctgcgtgaaatcgtcgacagcctgaag
agcacctactgcggtaccttcggcgccgagttcatgcacatcgtcgattccgagcagcgc
aagtggttcctccagcgtctggaaagcgtgcgtggtcgtcccggcttctccgccgaggcg
cgtgcgcacctgctcgagcgcctgaccgcggccgaaggcctggagaagtacctgggcacc
aagtacccgggcaccaagcgtttcggcctggaaggcggcgaaagcctgatcccgatggtc
gacgagatcatccagcgctgcggttcctacggcgccaaggaaatcgtcatcggcatggcc
caccgcggtcgcctgaacgtcctggtcaacaccctgggcaagaacccgcgcgacctgttc
gacgagttcgaaggcaagaagatcgtcgagctgggctccggtgacgtgaagtaccaccag
ggcttctcctcgaacgtgatgaccagcggtggcgaagtccacctggcgctggcgttcaac
ccgtcccacctggaaatcgtttccccggtggtcgagggttccgttcgtgctcgccaggac
cgccgcaaggacagctccggcgacaaggtggtaccgatttccatccacggcgatgccgcc
ttcgcggggcagggcgtggtcatggaaaccttccagatgtcgcagacccgcgcctacaag
accggtggcaccatccacctggtgatcaacaaccaggtcggtttcaccaccagccgccag
gacgatgcgcgttccaccgagtacgccaccgacgtggcgaagatgattcaggcgccgatc
ttccacgtcaacggcgacgatcccgaagccgtgctgttcgtcacccaactggccgtcgac
taccgcatgcagttcaagcgtgacgtggtcatcgacctggtctgctaccgtcgccgcggc
cacaacgaggcggacgagccgagcggcacccagccgctgatgtaccagcagatcgccaag
cagcgtactacccgcgagctgtacgccgatgccctggtgaatgccggcgtgctcagcgcc
gagcaggttcagtcgaagatcgacgactaccgcgacgcccttgacaacggcctgcacgtg
gtgaagagcctggtcaaggaacccaacaaggaactgttcgtcgactggcgtccgtacctg
ggtcatgcctggaccgcgcgtcacgacacccgcttcgacctgaagaccctgcaggaactg
tccagcaagatgctggaagtgccggaaggcttcgtggttcagcgccaggtttcgaagatc
tacgaagatcgccagaagatggcggccggtggcctgccgatcaactggggcttcgccgag
accctggcctacgcgaccctgctgttcgaaggccatccggtacggatgaccggccaggac
gtcggccgtggcaccttctcgcaccgtcacgcggtgctgcacaaccagaaggatgactcg
gtctacgtaccgctggccaatctgttcgacggccagccgcgcctggatatctacgattcc
ttcctttcggaagaggccgtgctggcgttcgaatacggtttcgccaccaccacgccgaac
tcgctggtgatctgggaagcccagttcggcgacttcgccaacggcgcccaggtggtcatc
gaccagttcatcaccagtggcgaaagcaaatggggccgactctgcggcctgaccatgctg
ctgccgcacggctatgaggggcagggcccggagcactcctccgcgcgcctggagcgctac
ctgcagctctgtgccgagcagaacatccaggtctgcgtgccgaccaccccggctcaggtc
taccacatgctccgccgtcaggtgatccgcccgctgcgcaagccgctggtggtgatgacg
ccgaagtccctgctgcgtcacaagctcgccatctcgaccctggaagatctggccaacggt
tccttccagaccgtgatcccggaaatcgacagcctggatccgaagaaggtcgaccgcgtc
gtgctgtgcagcggcaaggtgtactacgacctgctggagaagcgtcgcgcggaaggccgc
gaagataccgcgatcgtccgtatcgagcagctgtatccgttcccggaagacgacctggcg
gaagttctggctccgtacaagaacctcaagcacatcgtctggtgccaggaagagccgatg
aaccagggcgcctggttctgcagccagcatcacatgcgtcgtgtcatcgccgcgcacaag
aagggcctcaacctcgagtacgccggccgcgaaggctccgctgctccggcttgcggctac
gcctcgatgcacgccgagcagcaggaaaaactgctgcaagacgcctttactgtttaa

DBGET integrated database retrieval system