KEGG   Pseudomonas aeruginosa M18: PAM18_3463
Entry
PAM18_3463        CDS       T01973                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00190  Oxidative phosphorylation
paf00650  Butanoate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3463 (sdhB)
   00650 Butanoate metabolism
    PAM18_3463 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3463 (sdhB)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAM18_3463 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PAM18_3463 (sdhB)
SSDB
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Other DBs
NCBI-ProteinID: AEO75946
Position
complement(3855861..3856568)
AA seq 235 aa
MLQVSVYRYNPDKDAAPYMQDFQVDTNGKDVMVLDVLALIKEQDEGFSYRRSCREGVCGS
DGMNINGKNGLACITPLSAAGLKGGKLVIRPLPGLPVIRDLVVDMSIFYKQYEKVKPFLQ
NDTPAPAIERLQTPEEREKLDGLYECILCACCSTSCPSFWWNPDKFLGPAALLQAYRFLA
DSRDTKTEERLASLDDPFSVFRCRGIMNCVNVCPKGLNPTKAIGHVRNMLLQSGT
NT seq 708 nt   +upstreamnt  +downstreamnt
atgttgcaagtgagtgtttatcgttacaaccccgacaaagatgctgcgccgtacatgcag
gatttccaggtcgacaccaacggcaaggacgtgatggtcctcgacgtgctggcgctgatc
aaggaacaggacgagggcttctcctaccgtcgttcctgccgtgaaggcgtctgcggctcc
gatggcatgaacatcaacggcaagaacggcctggcctgcatcaccccgctgtcggccgcc
ggcctgaagggcggcaagctggtgatccgtccgctgcccggcctgccggtcattcgtgac
ctggtcgtggacatgagcatcttctacaagcaatacgagaaggtgaagccgttcctgcag
aacgatacgccggccccggccatcgagcgtctgcagaccccggaagagcgcgagaagctg
gacggtctgtacgagtgcatcctgtgcgcctgctgctcgacctcctgcccgtccttctgg
tggaaccccgacaagttcctcggtccggccgcactgctgcaagcctatcgtttcctggcc
gacagccgtgacaccaagaccgaagagcgcctggcttcgctggacgatccgttcagtgtg
ttccgctgccgcggaatcatgaactgcgtgaacgtttgcccgaagggtctgaacccgacc
aaggcgatcggccacgtgcgtaatatgctgctgcagagcggaacctga

DBGET integrated database retrieval system