KEGG   Pseudomonas aeruginosa M18: PAM18_3464
Entry
PAM18_3464        CDS       T01973                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00190  Oxidative phosphorylation
paf00650  Butanoate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3464 (sdhA)
   00650 Butanoate metabolism
    PAM18_3464 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3464 (sdhA)
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PAM18_3464 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PAM18_3464 (sdhA)
SSDB
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO GIDA FAD_binding_3 HI0933_like Thi4 Pyr_redox_3
Other DBs
NCBI-ProteinID: AEO75947
Position
complement(3856580..3858352)
AA seq 590 aa
MASIRTLSFDAIIVGGGGAGMRAALQLAQGGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTETGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQANLKNGTSFLNEWYAVDLVKNQDGAV
VGIIAICIETGETVYIRSKAVVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINAHGERFMERYAPNAKDLAGRDVVARSMVKEV
LAGNGVGPNKDHVLLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPIPVIPTCHYMMG
GVATNIHGQAITQDANGNDQIVEGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKEGIDARGASESDLEASFKRLNGVNERTSGEEVAPLKRELQSCMQNYFGVFRTGE
YMQKGIAQLADLRERIANVKINDKSQAFNTARIEALELQNLLEVAEATAIAAEHRKESRG
AHAREDFEERDDENWLCHTLYFPGEKRVSKRSVNFAPKTVPAFEPKVRTY
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggctagcattcgtacactttcctttgacgccatcatcgtcggtggcggtggcgccggc
atgcgtgccgcgctgcaactggcccagggcggccacaagaccgccgtggtgaccaaggtc
ttcccgacccgttcccacaccgtatccgcacagggtggcatcacctgcgcgatcgcttcg
gccgacccgaacgacgattggcgttggcacatgtacgacaccgtcaagggctccgactac
atcggtgaccaggacgcgatcgaatacatgtgttccgtcggccccgaggccgtgttcgag
ctcgagcacatgggcctgccgttctcccgtaccgaaaccggccgcatctaccagcgtccg
ttcggcggccagtccaaggacttcggcaagggtggccaggccgcccgtacctgcgccgcc
gccgaccgtaccggccacgcgctgttgcacaccctgtaccaggccaacctgaagaatggc
acctcgttcctcaacgagtggtacgcggtcgacctggtgaagaaccaggacggcgcggtg
gtcggcatcatcgccatctgcatcgagaccggcgagaccgtctacatccgttccaaggcc
gtggtcctggccactggcggtgccggccgtatctacgcctccaccaccaacgcgctgatc
aacaccggtgacggcgtgggcatggccctgcgtgccggcgtgccggtgcaggacatcgag
atgtggcagttccacccgaccggcatcgccggcgccggtgtactggtcaccgaaggttgc
cgcggcgaaggcggttacctgatcaacgcccacggcgagcgcttcatggagcgttatgcg
ccgaacgcgaaggacctggccggccgcgacgtagtcgcccgttccatggtcaaggaagtc
ctggccggcaacggcgtgggcccgaacaaggaccacgtgctgctgaagctcgaccacctc
ggcgaggaagtcctgcacagccgcctgcccggcatctgcgaactgtccaagaccttcgcc
cacgtcgacccggtcgttgcgccgatcccggtgatcccgacctgccactacatgatgggt
ggcgttgccaccaacatccatggccaggccatcacccaggacgccaacggcaacgaccag
atcgtcgaaggcctgttcgccgtgggcgaagtggcctgcgtatcggtacacggcgccaac
cgcctgggcggcaactcgctgctcgacctggtggtattcggccgtgccgccggtctgcac
ctggaaaaagcgctgaaagagggcatcgacgcccgcggcgcttccgagagcgacctggaa
gcctccttcaagcgcctgaacggcgtgaacgagcgcaccagcggcgaagaagtcgctccg
ctcaagcgcgagctgcaaagctgcatgcagaactacttcggtgtgttccgcaccggcgag
tacatgcagaagggcatcgcccagctggccgacctgcgcgagcgtatcgccaacgtcaag
atcaacgacaagagccaggcattcaacaccgcgcgcatcgaagcgctggaactgcaaaac
ctccttgaggtggccgaggccaccgcgatcgcggccgagcaccgcaaggagtcccgtggc
gcccacgcccgtgaagacttcgaggagcgcgacgacgagaactggctgtgccacaccctg
tacttcccgggtgagaagcgcgtatccaagcgttccgtcaacttcgcgccgaagaccgtt
ccggcattcgaacccaaggttcggacttactaa

DBGET integrated database retrieval system