KEGG   Pseudomonas aeruginosa M18: PAM18_3466
Entry
PAM18_3466        CDS       T01973                                 

Gene name
sdhC
Definition
(GenBank) succinate dehydrogenase (C subunit)
  KO
K00241  succinate dehydrogenase / fumarate reductase, cytochrome b subunit
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00190  Oxidative phosphorylation
paf00650  Butanoate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
paf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3466 (sdhC)
   00650 Butanoate metabolism
    PAM18_3466 (sdhC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3466 (sdhC)
SSDB
Motif
Pfam: Sdh_cyt Fumarate_red_D
Other DBs
NCBI-ProteinID: AEO75949
Position
complement(3858718..3858978)
AA seq 86 aa
MLLFALDKSLSSEEGFEQVKACLTSPLAKLVIWGLLSALLYHLVAGVRHLVMDAGVGETL
EGGKRGSKIVIAIAVVLIVLAGVWVW
NT seq 261 nt   +upstreamnt  +downstreamnt
gtgctgctgttcgcgctcgacaagtcgctgagttcggaagaaggcttcgagcaggtgaag
gcgtgcctgaccagtcccctggccaagctggtgatctggggcctgctgtctgcgctgctg
taccacctggtggccggtgttcgccacctggtcatggacgctggcgtcggcgagacgctg
gaaggcggtaagcgtggctccaaaatcgtcatcgccatcgcggtggtgctgatcgttctg
gcgggggtatgggtatggtaa

DBGET integrated database retrieval system