KEGG   Pseudomonas aeruginosa M18: PAM18_3467
Entry
PAM18_3467        CDS       T01973                                 

Gene name
gltA
Definition
(GenBank) type II citrate synthase
  KO
K01647  citrate synthase [EC:2.3.3.1]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00630  Glyoxylate and dicarboxylate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
paf01210  2-Oxocarboxylic acid metabolism
paf01230  Biosynthesis of amino acids
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3467 (gltA)
   00630 Glyoxylate and dicarboxylate metabolism
    PAM18_3467 (gltA)
Enzymes [BR:paf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.1  citrate (Si)-synthase
     PAM18_3467 (gltA)
SSDB
Motif
Pfam: Citrate_synt
Other DBs
NCBI-ProteinID: AEO75950
Position
3859453..3860739
AA seq 428 aa
MADKKAQLIIEGSAPVELPVLSGTMGPDVVDVRGLTATGHFTFDPGFMSTASCESKITYI
DGDKGVLLHRGYPIEQLAEKSDYLETCYLLLNGELPTAAQKEQFVGTIKNHTMVHEQLKT
FFNGFRRDAHPMAVMCGVIGALSAFYHDSLDINNPKHREVSAHRLIAKMPTIAAMVYKYS
KGEPMMYPRNDLNYAENFLHMMFNTPCETKPISPVLAKAMDRIFILHADHEQNASTSTVR
LAGSSGANPFACIASGIAALWGPAHGGANEAVLRMLDEIGDVSNIDKFVEKAKDKNDPFK
LMGFGHRVYKNFDPRAKVMKQTCDEVLQELGINDPQLELAMKLEEIARHDPYFVERNLYP
NVDFYSGIILKAIGIPTSMFTVIFALARTVGWISHWQEMLSGPYKIGRPRQLYTGHTQRD
FTALKDRG
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggctgacaaaaaagcgcagttgatcatcgagggctcagcccccgtcgaactgcccgtc
ctatccggtaccatgggtcccgatgtagtggatgtacggggcctcaccgccacgggccac
ttcaccttcgatcctggcttcatgtcgaccgcctcctgcgagtcgaagatcacctatatc
gacggcgacaaaggcgtcctccttcatcgcggctaccccatcgagcaactggcagagaaa
tccgactacctggaaacctgctacctgctgctgaacggcgagctgcccaccgccgcgcag
aaggaacagttcgtcggcaccatcaagaaccacaccatggttcacgagcagttgaagacc
ttcttcaacggcttccgccgcgacgcccatccgatggccgtgatgtgcggcgtgatcggc
gccctctcggccttctaccacgactccctggacatcaataacccgaagcatcgcgaagtc
tccgcgcatcgcctgatcgccaagatgccgaccatcgccgccatggtgtacaagtactcc
aagggcgagccgatgatgtatccgcgtaacgacctgaactacgcggaaaacttcctccac
atgatgttcaacaccccctgcgagaccaagccgatcagccccgtgctggccaaggccatg
gaccgcatcttcattctccacgccgaccacgagcagaacgcctccacctccacggtgcgt
ctggccggctcctccggcgccaatccgttcgcctgcatcgcctccggcatcgccgccctg
tggggaccggcccatggcggcgcgaacgaagcggtgctgcgcatgctcgacgagatcggc
gacgtgtccaacatcgacaagttcgtcgagaaggccaaggacaagaacgatccgttcaag
ctgatgggcttcggccatcgtgtctacaagaacttcgacccgcgcgccaaggtcatgaag
cagacctgcgacgaggtcctccaggagctgggcatcaacgacccgcaactggaactggcg
atgaagctggaagaaatcgcccgccacgacccctacttcgtggaacgcaacctgtacccg
aacgtcgacttctactcggggatcatcctcaaggcgatcggcattccgaccagcatgttc
accgtgatcttcgccctggcgcgtaccgtcggctggatctcgcactggcaggagatgctc
tccggcccctacaagatcggccgcccgcgccagctctataccggccacacccagcgcgac
ttcaccgccctcaaggatcgcggctga

DBGET integrated database retrieval system