KEGG   Pseudomonas aeruginosa M18: PAM18_3469
Entry
PAM18_3469        CDS       T01973                                 

Definition
(GenBank) putative Fe-S-cluster oxidoreductase
  KO
K06940  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3469
SSDB
Motif
Pfam: CxxCxxCC
Other DBs
NCBI-ProteinID: AEO75952
Position
complement(3861595..3861849)
AA seq 84 aa
MQCRAGCGACCIAPSISSPLPGMPAGKPAGVRCLHLDENHLCGLFGRPERPAVCGQFGAD
PEICGDSREQALALIAEWEVITAA
NT seq 255 nt   +upstreamnt  +downstreamnt
atgcaatgtagagccggctgcggcgcctgctgcatagcaccgtcgatttcctctccgctg
ccgggcatgccggccggcaagcccgcgggcgtacgctgcctgcacctggacgaaaatcat
ctctgcgggctgttcggccgaccggagcgaccggccgtatgcggccagttcggcgccgat
ccggaaatctgcggcgacagccgtgagcaggcgctggccctgatcgcggagtgggaagtc
atcactgccgcttga

DBGET integrated database retrieval system