KEGG   Pseudomonas aeruginosa M18: PAM18_3470
Entry
PAM18_3470        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Other DBs
NCBI-ProteinID: AEO75953
Position
complement(3861953..3862708)
AA seq 251 aa
MRLHKRSLVWGLALSGLAVVLAAAWWASQASREPALWSELRVPPAFAIPRDFDLGEYRLS
WGGKSLALSVAGSARPPLWESEGGFLGAGRESAGRLQLRCQEQSLESFELVGRRLSLKGH
LRCADGRLSAYELSFEPRQGGMEVRVALADSELNRVALSWRRGAGERLSGIVDDEVEGRS
WVLPAGVAGYWSSAGNAFLGHSTAAQSLDLREPGRVQWRAATESARAWLFAAGNREQWQL
RSARLEAETRR
NT seq 756 nt   +upstreamnt  +downstreamnt
atgcggttgcacaaacgctcgctggtctgggggctcgccttgagcgggctggccgtcgtg
ctggcggccgcctggtgggcgagccaggcgtcgcgggagccggctctgtggagcgagctg
cgggtgccgccggcgtttgccatcccgcgcgatttcgacctgggcgaataccgcttgagc
tggggcggcaagagcctcgccctgtcagtggcgggtagcgctcggccgccgttgtgggag
agcgagggcggttttctcggggccgggcgggaaagcgccggtcgcctgcagttgcgctgc
caggagcagagcctggagagcttcgaactggtcggtcgacgcttgtccctgaaggggcac
ctgcgctgcgccgatggccggctcagcgcctacgagctgtcgttcgagccgcgccagggc
ggcatggaggtgcgcgtcgcgctggcggacagcgagctgaaccgggtcgccctgtcctgg
cggcgtggagcgggggagcgcttgtccggtatcgtcgatgacgaggtggaaggtcgctcc
tgggtcttgccggccggggtcgccggctactggagttccgctggcaacgccttcctcggc
cactcgacggcggcgcaatccctcgacctgcgcgagccgggccgcgtgcaatggcgggca
gcgacggagtcggccagggcctggctgttcgctgccggcaaccgcgagcagtggcagctt
cgcagcgcgcgtctcgaggcggaaacgcgccgctga

DBGET integrated database retrieval system