KEGG   Pseudomonas aeruginosa M18: PAM18_3471
Entry
PAM18_3471        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K09922  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3471
SSDB
Motif
Pfam: DMT_6
Other DBs
NCBI-ProteinID: AEO75954
Position
3862824..3863165
AA seq 113 aa
MPVWLQTALLLACSNLFMTFAWYGHLKTLNSKPWIIAALISWGIALFEYLLQVPANRIGY
TELSVGQLKIMQEVITLAIFVPFSVYFMQQPLKLDYLWAGLCLLGAVYFIFRA
NT seq 342 nt   +upstreamnt  +downstreamnt
atgcccgtctggctgcaaaccgccttgttgctagcctgttccaacctgttcatgaccttc
gcctggtatggtcatctgaagactctcaacagcaagccctggatcatcgccgccctgatc
agttggggtatcgcgctgttcgaatacctgctgcaggtaccggccaaccgcatcggctac
accgaactctcggtcggccaactgaagatcatgcaggaagtcatcaccttggcgatcttc
gtcccgttcagcgtctacttcatgcaacagccgctgaaactggactacctctgggccggc
ctgtgcctgctcggcgcggtgtacttcatcttccgcgcctga

DBGET integrated database retrieval system