KEGG   Pseudomonas aeruginosa M18: PAM18_3472
Entry
PAM18_3472        CDS       T01973                                 

Definition
(GenBank) putative 3-hydroxyisobutyrate dehydrogenase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored Shikimate_DH 2-Hacid_dh_C 3HCDH_N ApbA NAD_binding_7 IlvN
Other DBs
NCBI-ProteinID: AEO75955
Position
complement(3863172..3864038)
AA seq 288 aa
MTAVAFLGLGTMGYPMAGHLQREGYDVCVYNRSSAKALRWVEEYAGRRADTPREACAGAE
LVFCCVGNDDDLRAVALGEQGAFAGMAPGSLFVDHTTASAEVARELSLLAAERELGFLDA
PVSGGQAGAVNGALTVMVGGEEAFYRRAEPLLRSYARMVRRMGDVGSGQLTKMVNQICVA
GLLQGLAEALHFARCAGLDGEAAMQVIGKGAAQSWQLENRHQSMLAGEFDFGFAVDWMRK
DLSILLAEARRNGAQLPVTALVDQFYAEVQAMGGGRWDTSSLIARLRS
NT seq 867 nt   +upstreamnt  +downstreamnt
atgactgcggtcgcatttctcggcctgggcacgatgggctacccgatggccgggcacctg
caacgagagggctacgacgtctgtgtctacaatcgctcgtcggccaaggcgctgcgctgg
gtcgaggagtacgccggacggcgcgccgatacgccgcgcgaggcctgtgctggcgccgag
ctggtgttctgttgcgtcggtaacgacgacgacctgcgtgccgtggcgctgggcgagcag
ggcgccttcgccggaatggcgccgggcagcctgttcgtcgaccacaccaccgcttcggcg
gaagtcgcccgcgagctgtcgctgctggctgccgagcgtgagctgggctttctcgacgcg
ccggtctccggcggccaggcaggcgcggtcaacggcgccctgacggtgatggtcggtggc
gaggaggccttctatcgacgcgccgaaccgctgttgcgcagctatgcgcggatggtccgg
cgaatgggcgacgtgggtagcgggcaattgaccaagatggtcaaccagatctgcgtcgcg
gggctgctccagggcctggccgaggcgctgcacttcgcccggtgcgccggtctcgatggc
gaggcggcgatgcaggtgatcggcaagggcgcggcccagtcctggcaactggaaaaccgc
caccagagcatgctggccggagagttcgacttcggcttcgccgtggactggatgcgcaag
gacctgtcgatcctgctcgccgaggcgcggcgcaacggcgcgcagttgccggtcacggcg
ctggtcgaccagttctacgccgaagtgcaggcgatgggcggcggtcgttgggatacctcc
agcctgatcgcccggctgcgttcgtga

DBGET integrated database retrieval system