KEGG   Pseudomonas aeruginosa M18: PAM18_3473
Entry
PAM18_3473        CDS       T01973                                 

Definition
(GenBank) putative exonuclease
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: RNase_T DUF5051
Other DBs
NCBI-ProteinID: AEO75956
Position
3864142..3864693
AA seq 183 aa
MPHWLVIDLEATTAEGGWPLEEMEIIEIGATLVAAADARELDHFQRFVRPVRRPLLTHFC
RDLTHISQANVDGAAHLNTVWEAFERWLAQHRPRLAGWASWGDYDRRQLEQEWRQHGLTS
QLSEVPHVNLKQRFGEVRQLPRPVGLNAALQLAGMSFQGQQHRALEDARNTARLLPLVLP
VEH
NT seq 552 nt   +upstreamnt  +downstreamnt
atgcctcactggctggtaatcgatctggaggccaccaccgcggaaggcggctggcccctg
gaggaaatggaaatcatcgagatcggcgccaccctggtcgccgccgcggacgcccgcgaa
ctggaccacttccagcgtttcgtacggccggtcaggcggccgctgctgacccacttctgc
cgcgacctcacgcatatcagccaggccaacgtcgatggcgcagcccatctcaatacggtc
tgggaagccttcgagcgctggctcgcccagcatcgtccgcgactggccggctgggccagt
tggggcgactacgaccgccgccagttggagcaggaatggcgccagcacgggctgaccagc
cagctcagcgaagtgccgcacgtcaatctcaagcaacgcttcggcgaagtccgccagttg
ccccgcccagtcggcctgaacgcggccctgcaactggccgggatgagtttccagggccag
cagcaccgcgccctggaggatgcccgcaataccgcacggctgctgccgctggtattgccg
gtggagcattga

DBGET integrated database retrieval system