KEGG   Pseudomonas aeruginosa M18: PAM18_3474
Entry
PAM18_3474        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
  KO
K09913  purine/pyrimidine-nucleoside phosphorylase [EC:2.4.2.1 2.4.2.2]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00230  Purine metabolism
paf00240  Pyrimidine metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    PAM18_3474
   00240 Pyrimidine metabolism
    PAM18_3474
Enzymes [BR:paf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.1  purine-nucleoside phosphorylase
     PAM18_3474
    2.4.2.2  pyrimidine-nucleoside phosphorylase
     PAM18_3474
SSDB
Motif
Pfam: Ppnp Cupin_3 Beta-prism_lec CENP-C_C Cupin_2
Other DBs
NCBI-ProteinID: AEO75957
Position
3864788..3865069
AA seq 93 aa
MFKVNEYFDGTVKSIAFDMTAGPATIGVMAAGEYEFGTSQLEIMHVVAGALTVKLPGSDE
WQEYASGSQFTVPANSKFQLKVAQDTAYLCEYR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgttcaaggtcaacgaatacttcgacggcaccgtcaaatccatcgccttcgacatgacc
gccggcccggccaccatcggcgtgatggcggcaggcgaatacgagttcggcaccagccag
ctggagatcatgcatgtggtcgccggcgcgctgacggtcaagctgccgggcagtgacgag
tggcaggaatacgccagcggcagccagttcaccgtcccggcgaacagcaagttccagctc
aaggtcgcccaggacaccgcctacctctgcgaataccgctga

DBGET integrated database retrieval system