KEGG   Pseudomonas aeruginosa M18: PAM18_3475
Entry
PAM18_3475        CDS       T01973                                 

Definition
(GenBank) putative periplasmic protein
  KO
K09974  uncharacterized protein
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    PAM18_3475
SSDB
Motif
Pfam: DUF1287
Other DBs
NCBI-ProteinID: AEO75958
Position
complement(3865184..3865780)
AA seq 198 aa
MDKDVSGALRRLLLLAMLGLPLVAAAAVEPQRLVDAARAQVGVTLGYDPAYRQLDYPGGD
VPLQTGVCTDVVVRALRGQGLDLQKAVHEDMRRHFAAYPQQWGMKGTDRNIDHRRVPNLM
TWFSRQGLALAPSRDASAYRAGDIVAWRLDNGLLHIGVLSDRRLEGRPLVLHNIGAGVRE
EDLLFRYQVIGHYRFPQG
NT seq 597 nt   +upstreamnt  +downstreamnt
atggacaaggacgtatccggcgcgctgcgccgcctgttgctgctcgccatgctcggactg
ccgctggtggcggccgctgcggtcgaaccgcagcgactggtggatgcggcgcgtgcccag
gtgggcgtgaccctgggctacgacccggcctaccggcaactggactatccgggcggcgac
gtgccgctgcagaccggggtctgcaccgacgtagtggtccgtgcgctgcgcggacagggg
ctggatctacagaaggcggtgcacgaggacatgcgtcgccacttcgcggcctacccgcag
caatggggaatgaaaggtaccgaccgcaacatcgatcaccgccgcgtaccgaacctgatg
acctggttcagccgccagggcctggccctggcgcctagccgcgacgcttccgcctaccgg
gccggagacatagtcgcctggcgcctggacaacggcctgctgcatatcggagtgctttcc
gatcgcaggctggagggcaggccgctggtgttgcacaacatcggtgccggcgtgcgggaa
gaggacctgctgttccgctaccaggtcatcggccactaccgcttcccgcagggctga

DBGET integrated database retrieval system