KEGG   Pseudomonas aeruginosa M18: PAM18_3476
Entry
PAM18_3476        CDS       T01973                                 

Definition
(GenBank) putative ATP-NAD kinase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: NAD_kinase DAGK_cat
Other DBs
NCBI-ProteinID: AEO75959
Position
complement(3865791..3866936)
AA seq 381 aa
MDMFRLGLVVNPLAGLGGPVALKGSDGVAAEALARGAEPRALERTRVALECLLPLVEKIE
FLTFPGAMGGELLERMGFRHRLLGEWQGAVSSAADTRLAIERLQEAGVALILFAGGDGTA
RDVAGVVREQQPVLGIPAGVKIHSGVYAISPRAAGELARRLVEGGLVRLASGEVRDLDEE
ALRAGRVAARWYGEMTVPEEGHFMQHVKQAGMESEELVLVDLADWLAENWEDGVRYVLGP
GSTLHGLARNLGLETTLLGVDVLENGAVIARDVDEARLFELVDGHPAYLLVTAIGGQGHV
IGRGNQQISPRVLRAIGLERMRVVATKRKLGTLGGRPLLVDSGDPVLDDSFPDAIRVWAG
YKEELLYPLGYAKDQDAPAGA
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggacatgtttcgcctggggttggtggtcaatcccctggccgggcttggtggcccggtc
gccttgaagggtagcgacggggtggccgccgaggccctggccagaggcgccgaaccacgt
gcgctggagcgcacccgggtagccctggagtgcctgttgccgctggtcgagaagatcgag
ttcctaacctttcccggggccatgggtggcgagttgctcgagcgcatgggcttccgccat
cgcctgctcggcgagtggcagggagcggtcagcagcgcggcggatacccggttggcgatc
gagcgcctgcaggaggccggtgtcgccctgatcctgttcgccggtggtgatggcacagca
cgggatgttgccggggtggtgcgcgagcaacagccggtgctcggcattccggccggggtg
aagatccactccggggtctatgccatcagtccgcgcgcggccggcgaattggccaggcgc
ctggtcgagggcggcttggtgcgcctggccagcggcgaagtgcgcgacctcgacgaagag
gcgctgcgcgccggccgcgtcgccgcgcgttggtacggcgagatgacagtgccggaggag
ggccacttcatgcagcacgtgaagcaggcagggatggagtccgaggagctggtgctggtg
gacctcgccgactggctggcggaaaactgggaagacggcgtgcgctatgtgctcggaccg
ggctcgaccttgcatggcctggcgcgcaatctcggcctggaaaccaccctgctgggcgtc
gacgtgctggagaatggcgcggtgatcgcccgcgacgtcgacgaggcgcggctgttcgaa
ctggtggacggtcatccggcgtacctgctggtcaccgccatcggcggccagggccacgtg
atcggtcgcggcaaccagcagatcagtccccgggtgttgcgcgccatcggcctggagcgc
atgcgggtggtcgccaccaagcgcaagctggggaccctcgggggccggccgttgctggtc
gacagcggcgacccggtgctggacgacagcttcccggacgccatccgggtctgggccggc
tacaaggaagaactgctgtatccgctgggatacgcgaaggaccaggacgcgcccgcgggc
gcttag

DBGET integrated database retrieval system