KEGG   Pseudomonas aeruginosa M18: PAM18_3477
Entry
PAM18_3477        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Other DBs
NCBI-ProteinID: AEO75960
Position
3867146..3867325
AA seq 59 aa
MNSQHTDTAKRRVIPFNTQLHTGGAIIDAQGREIPITEVMIQRACRELDRSLEQEQKQA
NT seq 180 nt   +upstreamnt  +downstreamnt
atgaattcgcaacacaccgataccgccaagcgccgcgtgatccccttcaatacgcagctg
cacaccggtggcgccatcatcgacgcccagggccgggagatcccgatcaccgaggtgatg
atccagcgcgcctgccgcgaactggacaggtccctggagcaggaacagaagcaggcctga

DBGET integrated database retrieval system