KEGG   Pseudomonas aeruginosa M18: PAM18_3478
Entry
PAM18_3478        CDS       T01973                                 

Definition
(GenBank) putative transcriptional regulator
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: LysR_substrate HTH_1 PBP_like MarR_2 HTH_24
Other DBs
NCBI-ProteinID: AEO75961
Position
complement(3867394..3868275)
AA seq 293 aa
MSVSHAQLKAFHAVAVYGSFTRAAERLFLTQPAVSDQVRKLEERYGVLLFHRNKRSVRLS
ELGERLLAVTQRLFAIEAEAEELLSASSALQTGTLTLAVDAPVHVLPQIARFCERYPGIA
VRVETGNTDESLQRLFSYQADLALLGRDVSDERLLSLTLRNDPIVAFVSLSHPWAGRESI
RLADLDDMPLVLREQGSVTRQTLEEEMSRAGLRIRPAIQVEGREASREAVVAGIGVGVVS
AAEFGADTRVHALPIVDCQRRLTETLVCLREQRSRRIVETFLDLVGEDLPAPS
NT seq 882 nt   +upstreamnt  +downstreamnt
atgtcggtatcccatgcgcagttgaaggctttccatgcagtcgccgtgtacggcagcttc
acgcgcgccgctgagcgcctgtttctcacccagccggcggtttccgaccaggtgcgcaag
ctggaggagcgttacggcgtgctgctgttccaccgtaacaagcgctcggtgcgcctgagc
gaactgggcgagcgcctgctcgcggtgacccagcggctgttcgcgatcgaggccgaggcg
gaggagctgttgtccgcctccagcgccctgcagaccggcaccctgaccctggcggtggat
gcgccggtgcacgtattgccgcagatcgcgcgtttctgcgagcgctatccgggcatcgcg
gtgcgggtggagaccggcaataccgacgagtctctgcagcgactgttcagctaccaggcc
gacctggctctgttgggccgggacgtcagcgacgagcggttgctttcgctgaccctgcgc
aacgacccgatcgtcgccttcgtttcgctcagccatccgtgggccgggcgcgagtcgatc
cggctcgccgatctcgacgacatgccgctggtgctgcgcgagcagggctcggtgacccgc
cagaccctggaggaggagatgagccgcgccggcctgcggatccgtccggcgatccaggtc
gagggccgcgaggcctcgcgcgaggcggtggtggcggggatcggcgtgggggtggtgtcg
gccgcggagttcggcgccgacacgcgggtccatgcgctacccatcgtcgattgccagcga
cgcctgaccgagaccctggtgtgcctacgcgaacagcgttcgcggcggatcgtcgagacc
ttcctcgacctggtcggcgaggacctgccggcgccgagctag

DBGET integrated database retrieval system