KEGG   Pseudomonas aeruginosa M18: PAM18_3480
Entry
PAM18_3480        CDS       T01973                                 

Definition
(GenBank) putative Endoribonuclease L-PSP
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Ribonuc_L-PSP
Other DBs
NCBI-ProteinID: AEO75963
Structure
PDB: 
3K12

Position
3870070..3870423
AA seq 117 aa
MHIERFEVVKRRAEMALHGNTVYIGGQVADDPSGDIQDQTRQILENIDRLLQSVGSDRGQ
VLSVRILLAHREDYAGLNQVWDQWFPEGRAPTRACSLAELIDPRWRVEMIVVAARPQ
NT seq 354 nt   +upstreamnt  +downstreamnt
atgcatatcgaacgtttcgaagtcgtcaagcgtcgggccgagatggccctgcacggcaac
acggtctacatcggcggccaggtcgcagacgaccccagcggtgacatccaggaccagacc
cgccagatcctggagaacatcgaccggctgctccagagcgtcggcagcgaccgcggccag
gtgctctcggtacgcatactgctagcccaccgggaggactacgccggtctcaaccaggtc
tgggaccagtggtttcccgaaggccgggcgccgacccgcgcctgtagcctggccgagttg
atcgacccgcgttggcgggtggaaatgatcgtcgtcgccgcccgcccgcagtga

DBGET integrated database retrieval system