KEGG   Pseudomonas aeruginosa M18: PAM18_3481
Entry
PAM18_3481        CDS       T01973                                 

Definition
(GenBank) putative Glycine/D-amino acid oxidase
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: DAO NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_3 Trp_halogenase Lycopene_cycl UDPG_MGDP_dh_N FAD_binding_2
Other DBs
NCBI-ProteinID: AEO75964
Position
3870434..3871831
AA seq 465 aa
MTFRPFWLDQALRSEHAAPCPPLAGDTRADVCIVGGGYTGLWTAIMLKEHDPGLDVVLVE
ADLCGAGASGRNGGCALSWSAKFFTLERLFGLTEAIRLVKASEDSIRAIGAFCQRYDVEA
DYRLDGTLYTATNPAQIGSTDSVIAALERHGINSFVKRPLADVQRLAGSRRHLEGWFSPA
AATVQPGKLVRGLRRVALQLGVRLYEGTPMRGLEHGRPAEVVTPHGRVVAGRVVLALNAW
MARAFPQFERSVAIVSSDMLITEPRPDLLQEIGLTSGVSVLDSRIFVHYYHNTPDGRLML
GKGGNTFAYGGRMLPVFDRPSPYLGQLRGSLREFFPEFAEVAIEASWNGPSDRSVTGLPF
FGRLDGRDNVFYGFGYSGSGVGPCHMGGQILSSLALGLDNPWTRSPLTQGPLGRFPPEPI
RYVGSLMVRNAIRRKEHAEDAGRRPRHLDVRLARFAAAAGKADKG
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgaccttccgacccttctggctggaccaggccctacgctccgaacatgcggcaccctgc
ccgccgctggccggggatacccgcgccgacgtgtgcatcgtcggcggcggctacaccggc
ctgtggaccgccatcatgctcaaggagcacgatcccgggctcgacgtggtgctggtcgag
gccgatctctgcggcgccggcgccagcggccgcaacggcggctgcgcgctgtcctggtcg
gccaagttcttcaccctggaacggctgttcggactaaccgaggcgatccgcctggtcaag
gcctccgaggacagcatccgggccatcggcgccttctgccagcgctacgacgtcgaggcc
gactaccggctggacggcaccctctataccgccaccaacccggcccagatcggcagcacc
gacagcgtgatcgccgccctggaacgccatggcatcaactccttcgtcaagcgcccgctg
gccgacgtgcaacgcctggccggctcgcgccgacacctggaaggctggttctcgccggct
gccgcgacggtgcagccaggcaagctggttcgcggcctgcgccgggtcgccctgcaactg
ggggtacgcctgtacgaaggcacgccgatgcgaggactggagcacggccgcccggcggaa
gtggtcaccccccacgggcgggtcgtcgccggccgcgtggtgctggcgctgaacgcctgg
atggcgagggccttcccgcagttcgaacgcagcgtggcgatcgtctccagcgacatgctc
atcaccgagccacgaccggacctgttgcaggagatcggcctgaccagcggggtcagcgtg
ctcgactcacggatcttcgtgcattactaccacaacaccccggacggccggctgatgctc
ggcaagggcggcaacaccttcgcctacggcggacgcatgctaccggtgttcgaccgtccc
tcgccgtatctcggacaactgcgtggcagcttgcgggagttcttccccgagttcgccgag
gtcgccatcgaggccagctggaacggtccgtcggatcgctcggtgaccggcctgccgttc
ttcggccggctcgacggccgcgacaatgtgttctacggcttcggctactccggcagcggc
gtcggtccatgccacatgggcgggcagatcctttcttcgctggcgctcggcctggacaat
ccctggacccgttcgccgctgacccaggggccgctcggccgcttcccgccggagccgatc
cgctatgtcggttcgctgatggtgcgcaacgcgatccgtcgcaaggagcacgccgaagac
gccggccggcgcccgcgtcatctcgacgtacgcctggccaggttcgccgccgccgcgggc
aaggccgacaagggttga

DBGET integrated database retrieval system