KEGG   Pseudomonas aeruginosa M18: PAM18_3482
Entry
PAM18_3482        CDS       T01973                                 

Definition
(GenBank) putative glutamine synthetase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00220  Arginine biosynthesis
paf00250  Alanine, aspartate and glutamate metabolism
paf00630  Glyoxylate and dicarboxylate metabolism
paf00910  Nitrogen metabolism
paf01100  Metabolic pathways
paf01120  Microbial metabolism in diverse environments
paf01230  Biosynthesis of amino acids
paf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PAM18_3482
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PAM18_3482
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PAM18_3482
   00220 Arginine biosynthesis
    PAM18_3482
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3482
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:paf04147]
    PAM18_3482
Enzymes [BR:paf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     PAM18_3482
Exosome [BR:paf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PAM18_3482
SSDB
Motif
Pfam: Gln-synt_C
Other DBs
NCBI-ProteinID: AEO75965
Position
3872299..3873663
AA seq 454 aa
MNFACEQEAQDFLAANPDIELFELFILDANGVPRGKLLHRDELLAVYRSGRPLPSTILGL
TMNGEDVEDSGLVWDVGDIDCRAYPLSGSLVRLPWRQIPTAAVQVSMHPSEGLPASVADP
RHLLVRTIDALKSEGYHPVMAAELEFYLLDRERDANGRPQPARDADGGRPRATQVYGLRE
LEQIEPFLADLYAACKAQGLPARTAISEYAPGQVEITLDHGDALAAMDQAIRYKRLVKGI
AHKHGMLACFMAKPFDDLAGTGMHLHVSLADEQGHNLFASDDPAGTPLLRQAVGGMLASL
LDSLLLFCPNANSYRRFQANSYAPLAQTWGVDNRTVSLRVPGGPASSRHIEHRICGADAN
PYLAAAALLAGVHRGIREGIDPGAPVEGNGYAQAGKRLPTDWLTALDTLQGSEWAREAFG
EPFLGVYLAVKRAEYRQFMGEVSEQDWRWYLTQA
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgaacttcgcctgcgaacaagaagcccaggatttcctggccgccaaccccgacatcgaa
ctcttcgaactgttcattctcgacgccaacggcgtgccgcgcggcaagctgctgcaccgc
gacgagctgctggccgtctaccgcagcggccggccgctgccgagcaccatcctcgggctg
acgatgaacggcgaggacgtcgaggactccggcctggtctgggacgtcggcgacatcgac
tgccgcgcctaccccctgtccggcagcctggtgcgcctgccctggcgacagatcccgacg
gcggcggtgcaggtcagcatgcacccgagcgagggcctgcccgccagcgtcgccgatccg
cggcacctcctggtgcgaaccatcgacgcgctgaagagcgagggctatcacccggtgatg
gccgccgagctggagttctacctgctcgaccgtgagcgcgacgccaacggccgcccgcaa
ccggcccgcgacgccgatggcggccgcccacgggcgacccaggtctacggcctgcgcgaa
ctggagcagatcgagccgttcctcgccgacctctatgccgcctgcaaggcgcagggcctg
ccggcacgcacggcgatctcggaatatgccccgggccaggtggaaatcaccctcgaccac
ggcgacgccctcgccgccatggaccaggcgatccgctacaagcgcctggtcaagggcatc
gcgcacaagcacgggatgctcgcctgcttcatggccaagccgttcgacgacctggccggc
actggcatgcacctgcacgtcagcctggccgacgaacaaggccacaacctgttcgccagc
gacgaccccgccggcacgccgttgctgcgccaggcggtcggcggcatgctcgccagcctg
ctcgactcgctcctgctgttctgtcccaacgccaactcctaccggcgcttccaggccaac
agctacgcgccgctggcgcagacctggggcgtcgacaaccgcaccgtgagcctgcgcgtg
ccgggcggcccggcctccagtcggcatatcgagcaccgcatctgcggcgccgacgccaac
ccctacctggccgccgcggcgctcctcgccggggtccaccgcggcatccgcgaaggcatc
gatccgggtgcgccggtggagggcaacggctacgcccaggccggcaagcgcctgcccacc
gactggctgaccgccctcgataccctgcaaggctccgagtgggcgcgggaagccttcggc
gagccgttcctcggcgtctacctggcggtgaagcgcgcggaataccggcaattcatgggc
gaggtcagcgagcaggactggcgctggtacctgacccaggcctga

DBGET integrated database retrieval system