KEGG   Pseudomonas aeruginosa M18: PAM18_3483
Entry
PAM18_3483        CDS       T01973                                 

Definition
(GenBank) putative oxidoreductase
  KO
K09471  gamma-glutamylputrescine oxidase [EC:1.4.3.-]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00330  Arginine and proline metabolism
paf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    PAM18_3483
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     PAM18_3483
SSDB
Motif
Pfam: DAO FAD_oxidored NAD_binding_8 Pyr_redox_2 FAD_binding_3 Thi4 GIDA Pyr_redox FAD_binding_2 HI0933_like Pyr_redox_3 NAD_binding_9 UDPG_MGDP_dh_N Lycopene_cycl 3HCDH_N
Other DBs
NCBI-ProteinID: AEO75966
Position
3873732..3875042
AA seq 436 aa
MNAAIQPRPAAERAPSYYAATLNEETDYPTLLGAVTVDIAIIGGGFTGVATAVELAERGY
KVALVETHRIGWGASGRNGGQVTGSLSGDAAMHKQMRQWLGAEVEDFIWHLRWRGHEIIR
QRVEKYGIACDLRHGHLHAAMKASHMGELQASYEEAVRRGMGDQVVLLDKAGVQAHLETE
LYCGALKNTRNMHLHPLNLCIGEARAAAGLGALIFEHSEVLDIVHGPRPAVITREGRIEA
QQILLAGDVYHKLERRQLKGMIFPAMGGIVTTRPLGELAREINPQGLAVYDCRFVLDYYR
PTADGRLLFGGGANYSGRDSRDIAAELRPCIERTFPRLKGVEIEFQWSCAMGIVMNRIPQ
LGKLSDNVWYCQGYSGHGVATSHIMGEIMAKAMSGSLEQFDTFARCKHLRVPLGDLFGNP
MLAAGMWYYQLMEKLR
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgaacgcagcaatccaaccccgtccggccgcggaacgcgcgccgtcctactacgccgcc
acgctcaacgaggaaaccgactatccgaccctgctgggcgcggtgacggtcgacatcgcc
atcatcggcggcggcttcaccggcgtcgccacggcggtcgaactggccgagcgtggctac
aaggtagccctggtcgagacccatcgcatcggctggggcgccagcgggcgcaacggcggc
caggtcaccggcagcctgtccggcgacgcggcgatgcacaagcagatgcgccaatggctg
ggcgccgaggtcgaggacttcatctggcacctgcgctggcgcggccacgagatcatccgc
cagcgggtggagaagtacggcatcgcctgcgaccttcgccatggccacctgcacgcggcg
atgaaggccagccacatgggcgagctgcaggcctcctacgaggaggcggtgcgccgcggc
atgggcgaccaggtggtcctgctggacaaggccggcgtccaggcccacctggagaccgag
ctgtactgcggcgcgctgaagaacacccgcaacatgcacctgcacccgctcaacctgtgc
atcggcgaggccagggcggcggccggcctcggcgcgctgatcttcgaacattccgaggtg
ctggatatcgtccacggcccgcggccggcggtgattacccgcgagggaaggatcgaggcg
cagcagatcctgcttgccggcgatgtctaccacaagctcgaacgcaggcagctcaagggg
atgatcttcccggccatgggcggaatcgttaccacccggccgctgggcgagctggcacgg
gagatcaacccgcaggggctggcggtctacgattgccgcttcgtcctcgattactaccgc
cccaccgccgacggccgcctgctgttcggtggcggcgccaactactcgggccgcgactcg
cgggacatcgccgccgagctgcggccatgcatcgagcgcaccttcccgcgcctgaagggc
gtggagatcgagttccagtggagttgcgccatgggcatcgtgatgaaccggatcccccag
ctcggcaagctctccgacaacgtctggtactgccagggctactcggggcatggcgtggcc
accagccacatcatgggcgagatcatggccaaggcgatgagcgggagcctggagcagttc
gacaccttcgcccgttgcaagcacctcagggtgccgctgggcgacctcttcggcaatccg
atgctggccgccgggatgtggtactaccagctcatggagaagctgcgctga

DBGET integrated database retrieval system