KEGG   Pseudomonas aeruginosa M18: PAM18_3485
Entry
PAM18_3485        CDS       T01973                                 

Definition
(GenBank) putative RNA 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:paf03009]
    PAM18_3485
Enzymes [BR:paf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     PAM18_3485
Ribosome biogenesis [BR:paf03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    PAM18_3485
SSDB
Motif
Pfam: RlmM_FDX FtsJ
Other DBs
NCBI-ProteinID: AEO75968
Position
complement(3875398..3876456)
AA seq 352 aa
MNTLLMHCRPGFEGEVCAEIAEHAATLEIPGYAKSKPASAHVEFVCQDADGAERLMRRLR
FADLIFPRQWARGPGFIELPESQRIEVLLAELASYPVCGSLWLEVLDTNAGKEVSTFCRK
FEKPLRAALVKAGRLQEDPALPRLLLTFRSGREVFVGLAEPRNSALWPMGIPRLKFPREA
PSRSTLKLEEAWHQFIPRSEWDKRLAPDMLAVDLGAAPGGWTWQLVNREMRVTAVDNGPM
AENLMYSGLVDHQKVDGYQYRPRQRVDWMVCDIVEKPARTGALIETWIGEGLCREAVVNL
KLPMKQRYAEVRKILQRLRESFDARGLKVAIGCKQLYHDREEVTCHLRRLER
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgaataccctgttgatgcactgccggccaggcttcgaaggtgaagtctgcgccgaaatc
gccgagcatgcagccactctcgagattcccggctacgccaagagcaagccggccagcgcc
cacgtcgagttcgtctgccaggacgccgacggcgccgagcgcctgatgcgccgcctgcgt
ttcgccgacttgatcttcccgcgccagtgggcgcgcgggcccggcttcatcgaattgccg
gaaagccagcgcatcgaggtactgctggcggaactggcgagttatccggtttgcggcagc
ctctggctggaggtgctggacaccaatgccggcaaggaggtgtcgaccttctgccgcaag
ttcgagaaaccgctgcgcgcggcgctggtgaaggccgggcggttgcaggaggacccggcg
ctgccgcgcctgctgctgaccttccgctctggccgggaagtcttcgtcggcctcgccgag
ccgcgcaacagcgcgctctggccgatgggcatcccgcgcctgaagtttccccgcgaggcg
ccgagccgttcgacgctgaagctggaggaagcctggcaccagttcatcccgcgcagcgaa
tgggacaagcgcctggcgccggacatgctcgccgtggacctcggtgcggcgccgggcggc
tggacctggcaactggttaaccgggagatgcgggtgaccgccgtggacaacgggccgatg
gcggagaacctgatgtattccgggctggtcgaccaccagaaggtcgacggctaccagtac
cgcccgcgccagcgggtcgactggatggtctgcgacatcgtcgagaagccggcacgcacc
ggtgcgttgatcgagacctggatcggcgaagggctttgccgcgaggcggtggtcaacctc
aagctgccgatgaagcagcgctacgccgaggtgcgcaagatcctccagcgcctgcgcgag
agcttcgacgcgcgcggcctgaaggtagcgatcggctgcaagcagctgtatcacgaccgc
gaggaagtgacctgccatctacgccgcctcgaacgctga

DBGET integrated database retrieval system