KEGG   Pseudomonas aeruginosa M18: PAM18_3486
Entry
PAM18_3486        CDS       T01973                                 

Gene name
acnA
Definition
(GenBank) aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00020  Citrate cycle (TCA cycle)
paf00630  Glyoxylate and dicarboxylate metabolism
paf01100  Metabolic pathways
paf01110  Biosynthesis of secondary metabolites
paf01120  Microbial metabolism in diverse environments
paf01200  Carbon metabolism
paf01210  2-Oxocarboxylic acid metabolism
paf01230  Biosynthesis of amino acids
Module
paf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paf_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PAM18_3486 (acnA)
   00630 Glyoxylate and dicarboxylate metabolism
    PAM18_3486 (acnA)
Enzymes [BR:paf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     PAM18_3486 (acnA)
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: AEO75969
Position
3876783..3879515
AA seq 910 aa
MPALDSLKTLRSLAVDGKTYHYYSLPEAARTLGDLGKLPMSLKVLLENLLRWEDGSTVTG
DDLKALAGWLRERRSDREIQYRPARVLMQDFTGVPAVVDLAAMRAAMAKAGGDPQKINPL
SPVDLVIDHSVMVDKFASESAFEQNVEIEMQRNGERYAFLRWGQNAFDNFSVVPPGTGIC
HQVNLEYLGRTVWTKDEDGRTYAFPDTLVGTDSHTTMINGLGVLGWGVGGIEAEAAMLGQ
PVSMLIPEVIGFKLTGKLREGITATDLVLTVTQMLRKKGVVGKFVEFYGDGLADLPLADR
ATIANMAPEYGATCGFFPVDEITLGYLRLSGRPESTVKLVEAYSKEQGLWREKGHEPVFT
DTLHLDMGEVEASLAGPKRPQDRVALQNVASAFNEFLGLQLHPSSTEEGRLLSEGGGGTA
VGANAAFGEIDYQHDGQTHRLKNGAVVIAAITSCTNTSNPSVMMAAGLLAKKAVEKGLQR
KPWVKSSLAPGSKVVTDYFKAAGLTRYLDELGFDLVGYGCTTCIGNSGPLLEPIEKAIQQ
ADLTVASVLSGNRNFEGRVHPLVKTNWLASPPLVVAYALAGSVRINLSEEPLGTGKDGQP
VYLKDIWPSQKEIAEAIQKVDTEMFHKEYAEVFAGDEKWQAIQVPQSDTYEWQADSTYIQ
HPPFFEHIAEAPPAIADVEQARVLAVLGDSVTTDHISPAGNIKADSPAGRYLREHGVEPK
DFNSYGSRRGNHEVMMRGTFANIRIKNEMLGGEEGGNTLYVPSGEKLAIYDAAMRYQEDG
TPLVIVAGKEYGTGSSRDWAAKGTNLLGVKAVIAESFERIHRSNLVGMGVLPLQFENGQD
RKSLKLTGKEVLNIRGLGGELKPHMPLSVEVTREDGSQDSFKVLCRIDTLNEVEYFKAGG
ILHYVLRSML
NT seq 2733 nt   +upstreamnt  +downstreamnt
atgcctgctttggacagcctgaaaacccttcgcagtctcgctgtggacggcaagacctac
cactactacagcctcccggaagccgcccggaccctgggcgatctcggcaagctgccgatg
tcgctgaaggtcctgctggaaaacctcctgcgctgggaggacggcagcaccgtcaccggc
gacgacctcaaggccctcgccggctggctcagggagcgccgttccgaccgcgagatccag
taccgcccggcgcgagtcctgatgcaggacttcaccggggtgcccgcggtggtcgacctg
gccgccatgcgcgcggccatggccaaggccggcggcgacccgcagaagatcaacccgctg
tcgccggtggacctggtcatcgaccactcggtgatggtcgacaagttcgccagcgaatcg
gccttcgaacagaacgtcgagatcgagatgcagcgcaacggcgaacgctacgccttcctg
cgctggggccagaacgccttcgacaacttcagcgtggtaccgccgggcaccggcatctgc
caccaggtcaacctggagtacctgggccgcacggtctggaccaaggacgaggatggcagg
acctacgccttccccgacaccctggtcggcaccgactcccacaccaccatgatcaacggc
ctcggcgtgctcggctggggcgtcggcggcatcgaggcggaagccgccatgctcggccag
ccggtatcgatgctgatccccgaggtcatcggcttcaagctcaccggcaagctgcgcgag
ggcatcaccgccaccgacctggtgctgaccgtcacgcagatgctgcgcaagaagggcgtg
gtggggaaattcgtcgagttctacggcgacggcctggccgacctgcccctggcggaccgc
gccaccatcgccaacatggccccggaatacggcgccacctgcggcttcttcccggtggac
gagatcaccctcggctacctgcgcctgtccggacgtccggaaagcacggtcaagctggtc
gaggcctacagcaaggaacagggcctgtggcgtgagaagggccacgagccggtgttcacc
gacaccctgcacctggacatgggcgaagtcgaggccagcctggccggaccgaagcgcccg
caggaccgcgtggccctgcagaacgtcgccagcgccttcaacgagttcctcggcctgcaa
ctgcatccctccagcaccgaagaaggccgcctgctcagcgagggcggcggcggcaccgcg
gtcggcgccaacgccgccttcggcgagatcgactaccagcacgacggccagacccaccgc
ctgaagaacggcgcggtggtgatcgccgccatcacctcctgcaccaacacctccaacccc
agcgtgatgatggccgccggcctgctggcgaagaaggcggtggaaaaaggcctgcaacgc
aagccctgggtgaagagttcgctggcgccgggctccaaggtggtcaccgactacttcaag
gccgccggcctgacccgctacctcgacgaactcggcttcgacctggtcggctacggctgc
accacctgcatcggcaactccggcccgctgctggagccgatcgagaaagccatccagcag
gccgacctgaccgtcgcctcggtactctccggcaaccgcaacttcgaaggccgcgtgcac
ccgttggtgaagaccaactggctggcctcgccgccgctggtggtggcctacgccctggcc
ggcagcgtgcggatcaacctcagcgaggaaccgctgggcaccggcaaggacggccagccg
gtctacctgaaggacatctggccgagccagaaggaaatcgccgaggcgatccagaaggtc
gacaccgagatgttccacaaggagtacgccgaggtcttcgccggcgacgagaaatggcag
gcgatccaggtgccgcagtcggacacctacgagtggcaggccgactccacctacatccag
catccacccttcttcgaacacatcgccgaggcgccgccggccatcgccgacgtcgagcag
gcgcgggtgctggcggtgctgggcgactcggtgaccaccgaccacatctcccctgccggc
aacatcaaggccgacagcccggccggccgctacctgcgcgagcacggcgtggaaccgaag
gacttcaactcctacggctcccgtcgcggcaaccatgaggtgatgatgcgcggcaccttc
gccaacatccgcatcaagaacgagatgctcggcggcgaggaaggcggcaataccctgtac
gtgcccagcggcgagaaactggcgatctacgacgcggccatgcgttaccaggaggacggc
accccgctggtgatcgtcgccggcaaggaatacggcaccggctcgtcgcgcgactgggcg
gccaagggtaccaacctgctgggcgtgaaggcggtgatcgcggagagcttcgagcgcatc
caccgctccaacctggtcggcatgggcgtgctgccgttgcagttcgagaacggccaggac
cgcaagagcctgaagctgaccggcaaggaggtgctgaacatccgcggcctcggcggcgaa
ctcaagccgcacatgccgctcagcgtggaagtgacccgcgaggacggcagccaggacagc
ttcaaggtcctctgccgcatcgacaccctcaacgaggtcgagtacttcaaggccggcggc
atcctccactacgtgctgcgcagcatgctctga

DBGET integrated database retrieval system