KEGG   Pseudomonas aeruginosa M18: PAM18_3487
Entry
PAM18_3487        CDS       T01973                                 

Gene name
aer
Definition
(GenBank) aerotaxis receptor Aer
  KO
K03776  aerotaxis receptor
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf02020  Two-component system
paf02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:paf00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3487 (aer)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    PAM18_3487 (aer)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02035 Bacterial motility proteins [BR:paf02035]
    PAM18_3487 (aer)
Bacterial motility proteins [BR:paf02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    PAM18_3487 (aer)
SSDB
Motif
Pfam: MCPsignal PAS_3 PAS_9 PAS PAS_4 LMBR1 Syntaxin_2 PAS_8 DUF2530 DUF948
Other DBs
NCBI-ProteinID: AEO75970
Position
3879888..3881453
AA seq 521 aa
MRNNQPITQHERVYPAEQRLITTTNLKGIITYCNEAFIDISGFSREELMSAPHNLIRHPD
VPPAVFAHMWTTLKAGRPWMGIVKNRCKNGDHYWVSAYVTPIYDQGAVVGYESVRVKPTA
EQIQRAEALYRRLGAGKPAIPRRDRWLPVLLDWLPFILISQIGFLIGIWLNSWWGFILAG
LLAVPLGLAGLRWQKRGLKRLMRLAEQTTSDPLIAQMYTDSRGDQARLEMAILSQDARLK
TCLTRLQDTAEYLTEQARQADTLAHHSSAGLEQQRAETEQVATAVNEMAATTQEVANNVQ
LTADATQKANELTSRGRDIAAETRNAIQRLSESVGETGAAVSRLAQDSNEIGGVVDVIKG
IADQTNLLALNAAIEAARAGDQGRGFAVVADEVRSLAQRTAASTEQIHHLIAKLQNTAND
AVHTMESGLQQAEAGVQRVLEADSALVGISEAVSNITEMTTQIAAAAEEQSAVAEEINRN
ISTIAALAEQTSDEALRTAKLSEELTTTAQSQYSLVERFNR
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgcgcaacaatcagcccatcacccagcacgagcgcgtctatccggcggaacaacgcctg
atcaccaccaccaatctcaaaggcatcatcacctactgcaacgaagccttcatcgacatc
agcggcttcagccgcgaggagctgatgtccgcgccgcacaacctgatccgtcaccccgac
gtcccgccggcggtgttcgcccacatgtggaccaccctcaaagccggccgcccgtggatg
gggatcgtcaagaaccgctgcaagaacggcgaccactactgggtcagcgcctatgtcacg
ccgatctacgaccagggcgcggtggtcggctacgagtcggtgcgggtcaagccgaccgcc
gaacagatccagcgcgccgaggccctctaccgtcgcctcggcgccggcaagccggcgatc
ccccggcgcgaccgctggctgccggtactgctcgactggctgccgttcatcctgatcagc
cagatcggcttcctcatcggtatctggctgaactcctggtggggcttcatcctcgccggc
ctgctcgccgttccgctcggcctggccggactgcgctggcagaagcgcgggctgaagcgc
ctgatgcggctcgccgaacagaccacctccgacccgctgatcgcgcagatgtacaccgac
agccgcggcgaccaggcgcgcctggaaatggccatcctcagccaggacgcgcgcctgaag
acctgcctgacgcgcctgcaggacaccgccgaatacctcaccgaacaggcgcgccaggcc
gacaccctggcccaccacagctccgccggtctggaacagcagcgcgcagagaccgaacag
gtggccaccgcggtcaacgagatggccgccaccacccaggaagtggcgaacaatgtccag
ttgaccgccgacgccacacagaaggccaacgaactgacctcgcgcggccgcgacatcgcc
gcggagacgcgcaacgccatccagcgcctgtcggagtcggtgggcgagaccggggccgcg
gtgagtcgcctggcccaggacagcaacgagatcggcggcgtggtcgatgtgatcaagggc
atcgccgaccagaccaacctgctcgccctcaacgccgccatcgaggcggcgcgggccggc
gaccagggacgcggcttcgccgtggtggccgacgaagtgcgctcgctggcgcaacgcacc
gcggcctccaccgagcagatccaccacctgatcgccaagttgcagaacaccgccaacgat
gcggtacataccatggagagcggcctgcagcaggccgaagccggggtccagcgggtgctg
gaagccgacagcgcgctggtcggcatcagcgaggcggtcagcaacatcaccgagatgacc
acccagatcgccgccgccgcggaggaacagagcgcggtggccgaggaaatcaaccgcaac
atcagcaccatcgccgccctggccgagcagacctccgacgaggcgctgcgcacggcgaaa
ctgagcgaggaactgaccaccaccgcgcagagccagtattccctggtcgagcgcttcaac
cgctga

DBGET integrated database retrieval system