KEGG   Pseudomonas aeruginosa M18: PAM18_3488
Entry
PAM18_3488        CDS       T01973                                 

Definition
(GenBank) hypothetical protein
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: NAD_binding_4 Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 NmrA KR
Other DBs
NCBI-ProteinID: AEO75971
Position
complement(3881491..3882648)
AA seq 385 aa
MNMHADGEQITAIDTRERILLTGATGFLGGSVAAQLIAAGHGANLSFLVRAESRQQGLER
LRGNLLMHGVDEADCLALRAEQILCGDFLDTSWLARETPRLMQVERVINCAAVASFSKNP
TIWPVNVDGTFAFADVLSRSKRLKRFLHVGTAMCCGPQRESPISESWEFPAAEQQLVDYT
ASKAEIERRMREELPGLPLVVARPSIVVGHRTLGCQASGSIFWVFRMGFALESFTCGLDE
QIDVIPVDYCAEALIGLALKPCLGHSLYHISAGHRAACTFGEIDEAFARANGAAPVGERY
RKVEVDDLKELAKSFESRIGPANPRLVLRALRLYSGFADLNYLFDNSRLLEEGISAPPRF
TDYLDVCVQSSSAVSIPAQMQWDFK
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgaacatgcatgccgacggtgagcagatcaccgctatcgatacccgcgaacgcatcctg
ctgacgggggccaccggctttctcggcggttcggtcgccgcccagctgatcgccgccggg
cacggcgccaacctgtccttcctggtccgcgccgaatcccgccagcaggggctcgaacgc
ctgcgcggcaacctgctgatgcatggcgtcgacgaagccgactgcctggcactgcgggcg
gagcagatcctctgcggcgatttcctcgacacctcctggctggcccgcgagacgccgcgc
ctgatgcaggtggagcgggtgatcaattgcgccgccgtggcgtcgttctcgaagaacccg
accatctggccggtcaacgtcgacggcactttcgccttcgccgacgtgctgagccgttcg
aagcgactgaagcgtttcctccacgtcggtaccgcgatgtgctgcggaccgcagcgagag
tcgccgatcagcgagtcctgggaattcccggcggcggagcagcaactggtggactacacc
gcgtccaaggcggaaatcgagcggcgcatgcgcgaggaactgccgggcctgcccctggtg
gtggcgcggccatccatcgtggtgggccaccgtacccttggctgccaggcctccggcagc
atcttctgggtcttccgcatgggcttcgccctggaaagcttcacctgcggcctggacgag
cagatcgacgtgattccggtcgactactgcgccgaggcgctgatcggcctggcgctgaag
ccgtgcctggggcacagcctctatcatatctccgccggccatcgcgcggcctgcaccttc
ggcgagatcgacgaggccttcgcccgcgccaacggggcggcgccggtaggcgagcgctac
cgcaaggtggaggtggacgacctcaaggaactggcgaagagcttcgagtcgcgcatcggc
ccggccaatccgcgtctggtcctgcgcgcgttgcgcttgtacagcggctttgccgacctc
aactacctgttcgacaacagccgtctgctggaggaggggatctccgcgccgccgcgcttc
accgactacctcgacgtctgcgtgcagtcgtcaagcgcggtaagcatcccggcgcagatg
caatgggacttcaagtga

DBGET integrated database retrieval system