KEGG   Pseudomonas aeruginosa M18: PAM18_3490
Entry
PAM18_3490        CDS       T01973                                 

Definition
(GenBank) putative cytochrome oxidase subunit (cbb3-type)
  KO
K00404  cytochrome c oxidase cbb3-type subunit I [EC:7.1.1.9]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00190  Oxidative phosphorylation
paf01100  Metabolic pathways
paf02020  Two-component system
Module
paf_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3490
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3490
Enzymes [BR:paf01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     PAM18_3490
SSDB
Motif
Pfam: COX1
Other DBs
NCBI-ProteinID: AEO75973
Position
3883557..3884984
AA seq 475 aa
MSTTNPESAYNYKVVRQFAIMTVVWGIVGMTVGVLIAAQLVWPDLNFGLPWTSFGRLRPL
HTNAVIFAFGGCALFATSYYAVQRTCQVRLFSDTLASFTFWGWQLVILLAAISLPLGYTS
SKEYAELEWPIDILITVVWVAYAVVFFGTLVKRKVKHIYVGNWFFGGFILTVAMLHVVNN
LELPVTFTKSYSLYAGATDAMVQWWYGHNAVGFFLTAGFLGMMYYFVPKQAERPVYSYRL
SIVHFWALIAVYIWAGPHHLHYTALPDWAQSLGMVMSLILLAPSWGGMINGMMTLSGAWH
KLRSDPILRFLVVSLAFYGMSTFEGPMMAIKTVNALSHYTDWTIGHVHAGALGWVAMVSI
GSLYHLIPKVFGREKMYSLGLINAHFWLATIGTVLYIASMWVNGITQGLMWRAVNEDGTL
TYSFVEALAAGHPGFIVRMLGGFIFLLGMFLMAYNTWRTVSAAKPAEYEAAAQIA
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgagcaccactaacccagagtccgcctataactacaaggtggtccgccaattcgccatc
atgaccgtggtctggggcatcgtcggcatgaccgtcggtgtcctgatcgccgcccagctg
gtatggcccgacctgaacttcggcttgccgtggacgagcttcggccgcctgcgcccgctg
cacaccaacgcggtgatcttcgccttcggcggttgcgcactgttcgccaccagctactac
gcggtgcagcgcacctgccaggtgcgactgttctccgacaccctcgcctccttcaccttc
tggggctggcaactggtgatcctgctggccgccatcagcctgccgctgggctacacctcg
tccaaggagtacgccgagctggaatggccgatcgacatcctgatcacggtggtctgggtc
gcctacgcggtggtgttcttcggcaccctggtcaagcgcaaggtcaagcacatctatgtg
ggcaactggttcttcggcgggttcatcctcaccgtcgccatgctccacgtggtgaacaac
ctcgagctgccggtgaccttcaccaagtcctactcgctgtacgccggcgccaccgacgcc
atggtccagtggtggtacgggcataacgccgtgggcttcttcctcaccgccggcttcctc
ggcatgatgtactacttcgtgcccaagcaggccgagcgtccggtctactcctaccgcctg
tccatcgtccacttctgggcgctgatcgcggtgtacatctgggccggcccgcaccacctg
cactacaccgcgctgccggactgggcgcagtcgctgggcatggtgatgtcgctgatcctc
ctggcgccgagctggggcggcatgatcaacggcatgatgaccctctccggcgcctggcat
aagctgcgcagcgacccgatcctgcgcttcctggtggtgtccctggcgttctacggcatg
tccaccttcgaaggcccgatgatggcgatcaagaccgtcaacgccctctcccactacacc
gactggaccatcggccacgtacacgccggcgccctcggctgggtcgcgatggtttccatc
ggctcgctctaccacctgatcccgaaggtcttcggccgcgagaagatgtacagcctgggc
ctgatcaacgcgcacttctggctggccaccatcggtaccgtgctttacatcgcctcgatg
tgggtcaacggcatcacccagggcctgatgtggcgcgcggtcaacgaggacggcaccctg
acctactccttcgtcgaagcgctggccgccggccaccccggcttcatcgtgcgcatgctc
ggcggtttcatcttcctgctcggcatgttcctgatggcctacaacacctggcgcaccgtc
agtgccgccaagccggccgaatacgaagccgccgcacagatcgcctga

DBGET integrated database retrieval system