KEGG   Pseudomonas aeruginosa M18: PAM18_3491
Entry
PAM18_3491        CDS       T01973                                 

Definition
(GenBank) putative cytochrome c oxidase subunit
  KO
K00405  cytochrome c oxidase cbb3-type subunit II
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00190  Oxidative phosphorylation
paf01100  Metabolic pathways
paf02020  Two-component system
Module
paf_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3491
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3491
SSDB
Motif
Pfam: FixO Cytochrom_C
Other DBs
NCBI-ProteinID: AEO75974
Position
3884995..3885603
AA seq 202 aa
MKHEILEKNVGLLALCMAVAVSIGGLTQIVPLFFQDVTNTPVEGMKPYTALQLEGRDIYI
REGCVGCHSQMIRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGSRYSDDWH
RAHLFNPRNVVPESKMPAYPWLVENKLDGKDIEKKLEVMRTLGVPYTDEDIKGAKDSLKG
KTEMDAVVAYLQVLGTSIKNKR
NT seq 609 nt   +upstreamnt  +downstreamnt
atgaaacacgaaatactcgagaagaacgtcggcctgctggcgctatgcatggccgtggcc
gtgagcatcggcggcctgacccagatcgtgccgctgttcttccaggacgtgaccaacacc
ccggtcgaaggcatgaagccctataccgcgctgcaactggaaggccgcgacatctatatc
cgcgaaggctgcgtcggctgccactcgcagatgatccgtccgttccgcgccgaaaccgaa
cgctacggccactactcggtggccggcgagagcgtctgggaccaccccttcctgtggggt
tccaagcgtaccggtccggacctggcccgcgtcggtagccgctactccgacgactggcac
cgcgcacacctgttcaacccgcgcaacgtggtgcccgagtcgaagatgccggcctacccg
tggctggtggagaacaagctcgacggcaaggacatcgagaagaagctcgaagtgatgcgc
accctcggcgtgccctataccgacgaagacatcaagggcgccaaggactcgctgaaaggc
aagaccgagatggacgccgtggtcgcctacctgcaggtgctcggcacctcgatcaagaac
aaacggtga

DBGET integrated database retrieval system