KEGG   Pseudomonas aeruginosa M18: PAM18_3493
Entry
PAM18_3493        CDS       T01973                                 

Definition
(GenBank) putative cytochrome c
  KO
K00406  cytochrome c oxidase cbb3-type subunit III
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00190  Oxidative phosphorylation
paf01100  Metabolic pathways
paf02020  Two-component system
Module
paf_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3493
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3493
SSDB
Motif
Pfam: Cytochrome_CBB3 FixP_N Cytochrom_C Cytochrom_C550
Other DBs
NCBI-ProteinID: AEO75976
Position
3885791..3886717
AA seq 308 aa
MTTFWSLYITALTVGTLIALLWLVFATRKGEAKGTTEKTMGHSYDGIEEYDNPLPKWWFM
LYIGTIVFSVGYLVLYPGLGNWKGVLPGYEGGWTQDKQWEREMNIAQEKYGPIFAKYAAM
PIEEVAKDEHAMKMGSRMFATYCSICHGSDAKGALGFPNLADNEWRWGGDPQSIETTILG
GRHAIMAAWGDILGEDGVKNVAAYVRTELAGLKLPEGTKADVEAGKQIFSVNCVACHGPE
GKGTALVGAPNLTNPGAFIYGSSYAQLQQTIRHGRQGQMPAQEPYLGKEKVHILAAYIYN
LSHNQGSN
NT seq 927 nt   +upstreamnt  +downstreamnt
atgaccaccttctggagtctgtacatcacagctcttaccgtcggtaccttgatcgccctg
ctctggctggtcttcgccacccgcaagggcgaggccaagggtactaccgaaaagaccatg
ggccactcctacgacggcatcgaggagtacgacaatccgctgccgaagtggtggttcatg
ctgtacatcggcaccatcgtcttctccgtcggctacctggtcctgtacccgggcctgggt
aactggaaaggcgtgctgccgggctacgagggcggctggacccaggacaagcagtgggaa
cgcgagatgaacatcgcccaggagaagtacgggccgatcttcgccaagtacgccgccatg
cccatcgaggaagtggccaaggacgagcacgccatgaagatgggcagccgcatgttcgcc
acctactgctcgatctgccacggttccgacgccaagggcgccctcggcttccccaacctg
gccgacaacgagtggcgctggggcggtgacccgcagagcatcgagaccaccatcctcggc
ggtcgccacgcgatcatggcggcctggggcgacatcctcggcgaagacggggtgaagaac
gtcgccgcctacgtccgcaccgaactcgccgggctgaagctgccggaaggcaccaaggcc
gacgtcgaggccggcaagcagatcttctcggtcaactgcgtcgcctgccacggcccggaa
ggcaagggtaccgccctggtcggcgcgccgaacctgaccaaccccggcgcgttcatctac
ggctccagctacgcccagctccaacaaaccatccgccatggccgccagggccagatgccg
gcccaggagccctacctgggcaaggaaaaggtgcacatcctggccgcctacatctacaac
ctgtcgcacaaccagggcagcaactga

DBGET integrated database retrieval system