KEGG   Pseudomonas aeruginosa M18: PAM18_3495
Entry
PAM18_3495        CDS       T01973                                 

Definition
(GenBank) putative cytochrome c oxidase subunit
  KO
K00405  cytochrome c oxidase cbb3-type subunit II
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00190  Oxidative phosphorylation
paf01100  Metabolic pathways
paf02020  Two-component system
Module
paf_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3495
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3495
SSDB
Motif
Pfam: FixO Cytochrom_C EPSP_synthase DUF2860
Other DBs
NCBI-ProteinID: AEO75978
Position
3888524..3889135
AA seq 203 aa
MKNHEILEKNVGLLAIFMVIAVSIGGLTQIVPLFFQDVTNTPVEGMKPRTALELEGRDIY
IREGCVGCHSQMVRPFRAETERYGHYSVAGESVWDHPFLWGSKRTGPDLARVGGRYSDDW
HRAHLYNPRNVVPESKMPAYPWLVENKLDGKDTATKMEVLRKLGVPYTDEDIAGAREAVK
GKTEMDALVAFLQGLGTSIKSKR
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaagaaccacgaaatactcgagaagaacgtcggcctgctggccatcttcatggtgatc
gccgtcagcatcggcggcctgacccagatcgttccgctgttcttccaggacgtgaccaat
accccggtcgaaggcatgaagccgcgtaccgccctggaactggaaggtcgcgacatctac
atccgcgaaggctgcgtcggctgccactcgcagatggtccgtccgttccgtgccgagacc
gaacgctacggccattactcggtcgccggtgaaagcgtctgggaccacccgttcctgtgg
ggttccaagcgtaccggcccggacctggcccgcgtcggcggccgttactccgacgactgg
caccgcgcgcacctgtacaacccgcgcaacgtggtgcccgagtcgaagatgcctgcctac
ccgtggctggtagagaacaagcttgatggcaaggacaccgccaccaagatggaagtcctg
cgcaagctgggcgtgccttacaccgacgaggacatcgccggtgcacgtgaagccgtgaag
ggcaagaccgagatggacgccctggtggcgttccttcaaggcctgggaacctctatcaag
agcaaacggtga

DBGET integrated database retrieval system