KEGG   Pseudomonas aeruginosa M18: PAM18_3496
Entry
PAM18_3496        CDS       T01973                                 

Definition
(GenBank) putative cytochrome c oxidase subunit
  KO
K00407  cytochrome c oxidase cbb3-type subunit IV
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00190  Oxidative phosphorylation
paf01100  Metabolic pathways
paf02020  Two-component system
Module
paf_M00156  Cytochrome c oxidase, cbb3-type
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PAM18_3496
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PAM18_3496
SSDB
Motif
Pfam: FixQ
Other DBs
NCBI-ProteinID: AEO75979
Position
3889141..3889326
AA seq 61 aa
MDIGTLRGLGTVVIMVAFIGLVIWAYSGKRKKSFDEATMLPFADDPEAKKHVEQASRSNK
E
NT seq 186 nt   +upstreamnt  +downstreamnt
atggatatcgggactctgcgtggactgggcaccgtggtgatcatggtcgccttcatcggc
ctggtgatctgggcctacagcggcaagcgcaagaagagcttcgacgaagcgacgatgctg
cccttcgcagacgatcccgaagccaaaaagcacgtcgagcaagcttctaggagtaacaaa
gaatga

DBGET integrated database retrieval system