KEGG   Pseudomonas aeruginosa M18: PAM18_3498
Entry
PAM18_3498        CDS       T01973                                 

Definition
(GenBank) putative ferredoxin
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: Fer4_18 FixG_C Fer4_7 Fer4_17 Fer4_9 Fer4_8 Fer4_16 Fer4_10 Fer4_5 Fer4 Fer4_13 Fer4_21
Other DBs
NCBI-ProteinID: AEO75981
Position
3890497..3891912
AA seq 471 aa
MSKQIPVQDVTPPAKGDTNNNDLYAKREKIYTRAFTGIFRRLRMVGGAALFLLYFGTVWL
NWSGRQAVWWDLPERKFYIFGATFWPQDFMLLSWLLIVCAFGLFFITVFAGRVWCGYTCP
QSVWTWIYMWCEKVTEGDRNQRIKLDKAPMSGNKLLRKTAKHSLWLLIGLVTGLTFVGYF
SPIRELIPELLTGQADGWAYFWVGFFTLATYGNAGWLREQVCIYMCPYARFQSVMFDKDT
LIVSYDPRRGEKRGPRKKSLDYKAQGLGDCIDCTMCVQVCPTGIDIRDGLQIECIGCAAC
IDACDSIMEKMNYPKGLISYTTEHNLNGQKTHLARPRLIGYAIALVLMISALITAVVLRP
LVGFDVSKDRVLYRENELGRIENVYSLKIMNKDQQDHTYILGAKGLEGLTLEGRRELKVA
AGDILNLPMELSIEPEKLPSTTNEIVFTIESADDPSIHKEAKSRFIGPRTR
NT seq 1416 nt   +upstreamnt  +downstreamnt
atgagcaaacagattcccgttcaagacgtcaccccgcctgccaagggcgacaccaataac
aacgatctctacgccaagcgcgagaagatctacacccgggccttcaccggtatcttccgc
cgactgcgcatggtgggcggtgcggcgctcttcctcctctacttcggtaccgtctggctc
aactggagcggccgccaggccgtctggtgggacctacccgagcgcaagttctatatcttc
ggcgccaccttctggccgcaggacttcatgctgctgtcctggctgctgatcgtctgcgcc
ttcggcctgttcttcatcaccgtgttcgccggtcgcgtctggtgtggctatacctgcccg
cagagcgtgtggacctggatctacatgtggtgcgagaaggtcaccgaaggcgaccgcaac
cagcgcatcaagctggacaaggctccgatgagcggcaacaagctgctgcgcaagaccgcc
aagcacagcctgtggctgctgatcggcctggtcaccggcctgaccttcgtcggctacttc
tcgccgatccgcgagctgattcccgagctgctcaccggccaggccgacggctgggcctac
ttctgggtcggcttcttcaccctggccacctacggcaacgccggctggctgcgcgagcag
gtgtgcatctacatgtgcccctacgcgcgcttccagagcgtgatgttcgacaaggacacc
ctgatcgtctcctacgatccgcgtcgtggcgagaagcgcggcccgcgcaagaagtccctc
gactacaaggcccagggcctgggcgactgcatcgactgcacgatgtgcgtgcaggtctgc
ccgaccggcatcgacatccgcgacggcctgcagatcgagtgcatcggctgcgcggcgtgc
atcgacgcctgcgacagcatcatggagaagatgaactacccgaaagggctgatcagctac
accaccgagcacaacctcaacggccagaagacccacctggcccggccgcgcctgatcggc
tacgccatcgccctggtgctgatgatctccgccctgatcaccgcggtggtcctgcgtccg
ctggtcggcttcgacgtcagcaaggaccgcgtgctctaccgcgagaacgaactcggccgc
atcgagaacgtgtacagcctgaagatcatgaacaaggatcagcaggaccacacctacatc
ctcggcgccaagggtctcgaaggcctgaccctggaaggccggcgcgagctgaaggtggcg
gcgggcgacatcctcaacctgccgatggaactgtccatcgagccggagaagctgccttcg
accaccaacgagatcgtcttcaccatcgagtcggccgacgacccgagcatccataaagaa
gcgaagagtcgcttcattggcccacgcacccgttga

DBGET integrated database retrieval system