KEGG   Pseudomonas aeruginosa M18: PAM18_3500
Entry
PAM18_3500        CDS       T01973                                 

Definition
(GenBank) putative cation-transporting P-type ATPase
  KO
K01533  P-type Cu2+ transporter [EC:7.2.2.9]
Organism
paf  Pseudomonas aeruginosa M18
Brite
KEGG Orthology (KO) [BR:paf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAM18_3500
Enzymes [BR:paf01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.9  P-type Cu2+ transporter
     PAM18_3500
SSDB
Motif
Pfam: E1-E2_ATPase Hydrolase ATPase-cat_bd Hydrolase_3 HMA HAD CcmB
Other DBs
NCBI-ProteinID: AEO75983
Position
3892460..3894895
AA seq 811 aa
MSAPLPCYHCGLPVPAGSRFEARILGETRAMCCPGCQAVAEAIVAGGLESYYRHRSENAA
NPEALPKALSEELQLYDRPDVQGGFVRHEGELAETSLMIEGISCAACGWLIEKHLRQLPG
VAEARLNLSNHRLHVRWQDSQLPLSQLLGELRQIGYAGHPYQPDRATERLAMENRHALRQ
LGVAGLLWIQVMMAVMATWPEFNLDLSAGMDRILRWVSLILTTPIVFYCCGQFFRGALRD
LRTRHLTMDVSVSLAIGGAYVAGIWSTITGQGELYFDAVGMFALFLLAGRYLERRARERT
AASTAQLVNLLPASCLRLDAANQGERILLSELRVGDRVLVPPGAVLPADGVILDGQSSVD
ESLLTGEYLPHPRQAGDAVTGGTLNVEGPLTVEVGALGDDSRLSAIVRLLERAQADKPRL
AELADKVAQWFLLIVLLVAAAVGALWWQVDHQRAFWVVLSLLVATCPCALSLATPTALTA
ATGSLHKLGLLITRGHVLEGLNHIDTVIFDKTGTLTEGRLTLKQVLPLRDLDADRCLALA
AALENRSEHPIARAFGRAPEAADSVASHPGLGLEGLVEGRRLRIGQAAFVSNLGGSATPA
MPGDSGQWLLLGDEQGPLAWFGLDDRLRSDAPALLAACKARGWRTLLLSGDASPMVASVA
AELGIDEARGGLTPDDKLAILERLHGEGRRVLMLGDGVNDVPVLAGADISVAMGSATDLA
KTSADAVLLSNRLDSLVQAFRLARRTRHIIIENLAWASLYNGLVLPFAALGWITPGWAAI
GMSVSSLLVVVNALRLTRIPSPRSVWPRSTS
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgagcgcccccctgccctgctaccactgcggcttgccggtccccgccggcagccgcttc
gaggcccgcatactcggcgagacgcgggccatgtgctgtccgggctgccaggcggtggcc
gaggccatcgtcgccggcggcctggaaagctactaccggcaccgcagcgaaaacgccgcc
aatcccgaagccttgcccaaggcgctcagcgaagagttgcagctctacgaccgcccggac
gtacagggcggcttcgtccgccatgagggcgagctggcggaaaccagcctgatgatcgaa
ggcatcagttgcgccgcctgcggctggctgatcgagaagcacctgcgccagttgcctggc
gtggccgaggcgcggctcaacctgtccaaccatcgcctgcacgtgcgctggcaggacagc
cagttgccgctcagccagttgcttggcgaactgcgccagatcggctatgccggccatccc
taccaacccgaccgcgccaccgagcgcctggccatggagaaccgtcacgccctgcgccag
ctcggtgtcgccgggctgctgtggatccaggtgatgatggcggtaatggcgacctggccg
gaattcaacctcgacctttccgccggcatggaccgcatcctgcgctgggtcagcctgatc
ctcaccacgccgatcgtcttctactgctgcggccagttcttccgtggcgccctgcgcgac
ctgcgcacccgccacctgaccatggacgtctcggtgtcgctggcgatcggcggcgcctac
gtcgccggcatctggtcgacgatcaccggccagggcgagctgtatttcgacgcggtcggc
atgttcgccctgttcctcctcgccggccgctacctcgaacgccgcgcgcgggagcgcacc
gccgcctccaccgcgcaactggtcaacctgctgccggcgtcctgcctgcgcctggacgcc
gccaaccagggcgagcgcatcctgctcagcgaactgcgcgtcggcgaccgcgtactggta
ccgccaggcgccgtgctgccggccgacggagtgatcctcgacggccagtccagcgtcgac
gagtcgctgctcaccggcgagtacctgccccatccacgccaggccggcgacgccgtcacc
ggcggtaccctgaacgtcgaggggccgctgaccgtcgaggtcggcgcccttggcgacgac
agccgcctgtcggccatcgtccgcctgctggaacgcgcccaggcggacaagccgcgcctg
gcggaactggccgacaaggtggcgcagtggttcctgctcatcgtcctgctggtcgccgca
gcggtcggcgcgctgtggtggcaggtcgaccaccagcgcgccttctgggtggtgctgtcg
ctgctggtcgccacctgcccctgcgccctgtcgctggccacgcccaccgcgctcaccgcg
gccaccggcagcctgcacaagctcggcctgctgatcacgcgcgggcacgtgctggaaggg
ctgaaccacatcgacacggtaatcttcgacaagaccggcaccctcaccgaaggccgcctg
acgctcaagcaggtgctacccctgcgcgatctcgacgcggatcgctgcctggccctcgcc
gccgccctcgagaaccgttccgaacaccccatcgcccgcgccttcggccgtgcgccggag
gccgccgacagcgtcgcaagccatccgggactgggcctcgaaggcctggtggaaggccgc
cgcctgcgcatcggccaggccgccttcgtcagcaacctgggcggcagcgccacgcccgcg
atgcccggcgactccggacagtggctgctgctcggcgacgagcagggaccgctggcctgg
ttcggtctcgacgaccgcctgcgcagcgacgcccccgccctgctcgccgcctgcaaggcg
cgcggctggcgcaccctcctgctatccggtgacgcctcgccgatggtcgccagcgtcgct
gccgaactgggcatcgacgaagcccgcggcggcctgaccccggacgacaagctggccata
ctcgaacgcctgcacggcgagggccgccgggtgctgatgctcggcgacggagtcaacgac
gtaccggtgctcgccggtgccgacatcagcgtcgccatgggcagcgccaccgacctggcc
aagaccagcgccgacgcggtgctcctgtctaaccgcctggacagcctggtgcaggctttc
cggctggcgcgccgcacccgccatatcatcatcgagaacctggcctgggccagcctgtac
aatggcctggtcctgcccttcgccgcgctcggctggatcaccccgggctgggcggcgatc
ggcatgtcggtcagttcgctgctggtggtggtcaacgccctgcggctgacccgaatccct
tcgccgaggtccgtatggccgcgctctacatcctga

DBGET integrated database retrieval system