KEGG   Pseudomonas aeruginosa M18: PAM18_3501
Entry
PAM18_3501        CDS       T01973                                 

Definition
(GenBank) putative cytochrome oxidase maturation protein cbb3-type
Organism
paf  Pseudomonas aeruginosa M18
SSDB
Motif
Pfam: FixS Psg1
Other DBs
NCBI-ProteinID: AEO75984
Position
3894874..3895083
AA seq 69 aa
MAALYILIPVAIVIVAIAIYVFFWAVDSGQYDDLDGPAHSILFDDEDPKHQAGVDEAEKP
SKPEDRPRG
NT seq 210 nt   +upstreamnt  +downstreamnt
atggccgcgctctacatcctgatccccgtcgcgatcgtcatcgtcgccatcgccatctac
gtgttcttctgggcggtggacagcggccagtacgacgatctcgacggccccgcccacagc
attctcttcgacgacgaagacccgaagcaccaggccggcgtcgacgaagcggagaagccg
tcgaaacccgaggaccgaccgcgtggctga

DBGET integrated database retrieval system